KEGG   Botryotinia fuckeliana: BC1G_06802Help
Entry
BC1G_06802        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bfu  Botryotinia fuckeliana
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bfu01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bfu00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bfu00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bfu00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 502 aa AA seqDB search
MPLRAKIINPAFAGRAQMATASDTPSYAQAEVIKELESDEKEDVLFNSLYGVRTIELNRP
QKLHSLNGSMIRKIVPRLQEWSKSDMANVIIIKGSGPKAFCAGGDVAALAEDNKKGEEGQ
ARSTDYFALEYKLDHLIATYQKPYVAFMDGITMGGGVGLSIHAPFRIATERTLFAMPETT
IGFFPDVGASFFLPKMSGSVGTYLALTSDRLKGVNAFYSGIATHYIHSTSLPALEKRLAE
LRFKDFETLAQRAQLINSTIEEYCTGLPHDEPMLISGELRKAIDRNFSKASVPEIITGLK
AEIEVLKAGAEETGLENPLQAWLEKTLATLHQRSPTSVHVALRQMRIGKDWSITETFQRE
YQMAAKFMRHPDFTEGIDSLLIRKDKNPQWKPKTLEDISPEDKIADPFFAVEGSQRIKLL
SDRDYYEYPFQFGVPRESEVEKVVRQGGKSAFQVVNHFLQATEGKQGVKEVVTEIIERKT
TKSGLGYLEWEQDKISSPKSSE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgagagctaagattatcaatcctgcattcgcggggagagcacagatggcgacg
gcctcagataccccttcatacgcccaagcagaagtcattaaggagctggaaagtgacgag
aaggaagatgttctattcaattctttatatggcgtgaggacgatcgagctcaacagaccc
caaaagttacattccctcaatggatcgatgattcgaaaaatcgtgccgagattacaagaa
tggtcaaaatcagacatggcgaatgtgatcattattaaaggatctggacccaaggctttc
tgcgctggtggagatgtagcagcgctcgctgaggacaataaaaaaggcgaagaaggacaa
gctcgatcaacagattactttgctctcgaatataaactcgatcaccttattgcaacttat
cagaaaccctatgttgcttttatggacggtattaccatgggtggtggagttggattaagt
atacacgcaccatttcgaatagccactgaaaggacgctgttcgctatgcctgaaactaca
attggattcttccccgatgttggagcttcatttttcctacccaagatgtcgggatctgtt
ggaacataccttgccttgactagtgatcggctgaagggcgtcaatgcattttattctgga
atcgcaacacattacattcattcgacttctttgccggctttggagaaacgtttggcggaa
ttacgattcaaggatttcgaaactttggcgcagcgagcacaattgattaatagcactatt
gaggaatactgcactggactgcctcatgacgaaccaatgcttatcagtggcgaattgcga
aaggctatcgatcgtaacttcagtaaagcaagcgtccctgaaatcattaccggtttaaag
gccgagattgaagttttgaaggctggagcggaggaaaccgggttggaaaacccactccag
gcatggcttgaaaagactcttgctaccttgcaccagagatcacctacgagtgttcatgta
gcactacgtcaaatgcgcatcggaaaagattggtcaattaccgagactttccagagagaa
taccaaatggctgctaaatttatgcgtcatccggatttcacggaaggcatagattcatta
ctcattcgcaaagataagaatcctcagtggaaacccaaaactttggaagatatcagccca
gaggacaaaattgcggacccattctttgcagttgaaggatcacaaaggataaaactactc
agcgaccgggattattatgagtatccatttcaatttggagttccaagagaaagtgaagtt
gagaaggttgtgaggcagggtggaaagtcagcgttccaagttgtcaatcacttccttcag
gcaacggaagggaagcagggcgtgaaggaagtggtaacggagattattgaaagaaagact
acgaagagcgggctaggatatcttgaatgggaacaagataaaatctcaagtcctaagtcg
tcagagtga

DBGET integrated database retrieval system