KEGG   Botrytis cinerea: BC1G_06802Help
Entry
BC1G_06802        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
bfu  Botrytis cinerea
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_06802
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BC1G_06802
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1G_06802
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1G_06802
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     BC1G_06802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 502 aa AA seqDB search
MPLRAKIINPAFAGRAQMATASDTPSYAQAEVIKELESDEKEDVLFNSLYGVRTIELNRP
QKLHSLNGSMIRKIVPRLQEWSKSDMANVIIIKGSGPKAFCAGGDVAALAEDNKKGEEGQ
ARSTDYFALEYKLDHLIATYQKPYVAFMDGITMGGGVGLSIHAPFRIATERTLFAMPETT
IGFFPDVGASFFLPKMSGSVGTYLALTSDRLKGVNAFYSGIATHYIHSTSLPALEKRLAE
LRFKDFETLAQRAQLINSTIEEYCTGLPHDEPMLISGELRKAIDRNFSKASVPEIITGLK
AEIEVLKAGAEETGLENPLQAWLEKTLATLHQRSPTSVHVALRQMRIGKDWSITETFQRE
YQMAAKFMRHPDFTEGIDSLLIRKDKNPQWKPKTLEDISPEDKIADPFFAVEGSQRIKLL
SDRDYYEYPFQFGVPRESEVEKVVRQGGKSAFQVVNHFLQATEGKQGVKEVVTEIIERKT
TKSGLGYLEWEQDKISSPKSSE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgagagctaagattatcaatcctgcattcgcggggagagcacagatggcgacg
gcctcagataccccttcatacgcccaagcagaagtcattaaggagctggaaagtgacgag
aaggaagatgttctattcaattctttatatggcgtgaggacgatcgagctcaacagaccc
caaaagttacattccctcaatggatcgatgattcgaaaaatcgtgccgagattacaagaa
tggtcaaaatcagacatggcgaatgtgatcattattaaaggatctggacccaaggctttc
tgcgctggtggagatgtagcagcgctcgctgaggacaataaaaaaggcgaagaaggacaa
gctcgatcaacagattactttgctctcgaatataaactcgatcaccttattgcaacttat
cagaaaccctatgttgcttttatggacggtattaccatgggtggtggagttggattaagt
atacacgcaccatttcgaatagccactgaaaggacgctgttcgctatgcctgaaactaca
attggattcttccccgatgttggagcttcatttttcctacccaagatgtcgggatctgtt
ggaacataccttgccttgactagtgatcggctgaagggcgtcaatgcattttattctgga
atcgcaacacattacattcattcgacttctttgccggctttggagaaacgtttggcggaa
ttacgattcaaggatttcgaaactttggcgcagcgagcacaattgattaatagcactatt
gaggaatactgcactggactgcctcatgacgaaccaatgcttatcagtggcgaattgcga
aaggctatcgatcgtaacttcagtaaagcaagcgtccctgaaatcattaccggtttaaag
gccgagattgaagttttgaaggctggagcggaggaaaccgggttggaaaacccactccag
gcatggcttgaaaagactcttgctaccttgcaccagagatcacctacgagtgttcatgta
gcactacgtcaaatgcgcatcggaaaagattggtcaattaccgagactttccagagagaa
taccaaatggctgctaaatttatgcgtcatccggatttcacggaaggcatagattcatta
ctcattcgcaaagataagaatcctcagtggaaacccaaaactttggaagatatcagccca
gaggacaaaattgcggacccattctttgcagttgaaggatcacaaaggataaaactactc
agcgaccgggattattatgagtatccatttcaatttggagttccaagagaaagtgaagtt
gagaaggttgtgaggcagggtggaaagtcagcgttccaagttgtcaatcacttccttcag
gcaacggaagggaagcagggcgtgaaggaagtggtaacggagattattgaaagaaagact
acgaagagcgggctaggatatcttgaatgggaacaagataaaatctcaagtcctaagtcg
tcagagtga

DBGET integrated database retrieval system