KEGG   Botrytis cinerea: BC1G_07090Help
Entry
BC1G_07090        CDS       T01072                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfu  Botrytis cinerea
Pathway
bfu00010  Glycolysis / Gluconeogenesis
bfu00620  Pyruvate metabolism
bfu00640  Propanoate metabolism
bfu00680  Methane metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_07090
   00620 Pyruvate metabolism
    BC1G_07090
   00640 Propanoate metabolism
    BC1G_07090
  Energy metabolism
   00680 Methane metabolism
    BC1G_07090
Enzymes [BR:bfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1G_07090
Lipid biosynthesis proteins [BR:bfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1G_07090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-GeneID: 5435033
NCBI-ProteinID: XP_001554502
AA seq 651 aa AA seqDB search
MSEGKVKPSTPVVAEAHDVDTFRLDEYKKLYNESIKEPNKFWGRMARELLTWQKDFETVH
SGSFVGGDNAWFLEGQLNASFNCVDRHAIKNPDKPAIIYEADEASDGRTLTYSELLREVC
KTAYVLKQMGVKKGDTVAIYLPMIPEAVIAFLACSRIGAVHSVVFAGFSSDSLRDRVIDA
QSKVVITSDEGKRGGKLIGTKKIVDDALKQCPDVTHCLVYRRTGADVPMTEGRDWWWHEE
VEKWPSYIAPEPMNSEDPLFLLYTSGSTGKPKGVMHSTAGYLLGAAATGKYVFDIHDSDK
FFCGGDVGWITGHTYVVYAPLLLGVATVVFEGTPAYPNFSRYWDVIEKHEVTQFYVAPTA
LRLLKRAGDQHVKAQMKHLRVLGSVGEPIAAEVWKWYFEIVGKEEAHVVDTYWQTETGSN
VITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEGVLAFKQPWPSMARTVWG
AHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNVSGHRLSTAEIEAALIEH
HAVAEAAVVGINDELTGQAVNAFVAIKDGNEVNDSLKKDLILQVRKSIGPFAAPKAVFVV
PDLPKTRSGKIMRRILRKILAGEEDQLGDISTLSDPSVVEKIINIVHSARK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggaaaggtaaagccatctactcccgtagtagcagaagctcatgatgtcgat
acattccgactcgacgaatacaagaaactctacaatgaatcaatcaaagagcccaacaag
ttttggggaagaatggcccgtgaacttcttacctggcaaaaagatttcgagactgtacac
agcggatcgtttgtgggcggtgacaatgcctggttcttggagggtcaattaaatgcttca
ttcaattgtgttgatcgccatgcgatcaagaacccagacaagccagctatcatttacgaa
gccgatgaagctagcgatggtcgcactctcacatatagcgaacttctgcgagaagtttgc
aaaaccgcatatgttctcaaacaaatgggtgttaagaagggggacactgttgcgatttat
ctgcctatgattccagaagctgttattgctttcttggcttgttcgcgtattggtgcagtt
cactctgtagtctttgccggtttctcatccgattcccttcgagacagagttattgatgct
cagtcgaaagttgtgattacgtcggatgagggcaagcgtggtggaaaactcattggcaca
aagaagattgtggatgatgcgctgaaacaatgtcccgatgtcacgcactgtttggtttac
agacgtaccggtgccgacgttccaatgaccgaaggacgtgattggtggtggcatgaggag
gtcgagaaatggccatcttacattgctccagagccaatgaactccgaggatccattgttc
ttactttatacctctggatcaactggaaaaccaaagggtgttatgcactcaaccgctggt
tatcttttaggtgcggcagctactggaaagtatgtattcgatattcacgactcagataaa
ttcttctgtggcggtgatgttggatggattactggtcatacatatgtagtttatgcccct
cttcttcttggtgttgcaactgttgtgttcgaaggaactccagcatatccaaatttctcc
agatattgggatgttattgagaagcacgaggtcacacaattctatgttgcgcctacagcg
ctcagattattgaagcgtgccggtgatcaacatgtcaaggcacaaatgaagcacttgaga
gtattgggatcagttggtgaaccaattgctgccgaggtctggaaatggtatttcgagatt
gttggaaaggaagaagctcacgttgttgacacctactggcaaactgagaccggttccaat
gtcattactcctctcgcaggtgttacccctaccaagcctggtagtgcatcacttccattt
tttggtatcgagcctgcgattatcgaccctgtctccggagaagaaattcacggaaatgat
gtcgagggtgtattggctttcaagcaaccatggcccagtatggctcgtaccgtttgggga
gcacacaagagatatatggatacatatttgaacgtctacaaggggtactacttcactggt
gatggagcaggacgtgatcacgaaggttactactggatccgaggccgtgttgacgacgtt
gtcaacgtcagcggtcatcgtctctctaccgccgaaattgaagctgctttgattgagcat
catgctgttgccgaagctgcagtcgttggtatcaacgatgagcttactggacaagcagtc
aatgctttcgtcgctattaaggacggtaatgaggttaacgattcactgaagaaggatctc
atcttacaagtccgaaagagtatcggtccattcgcagctccaaaggcagtatttgttgtt
ccagatttgccaaagactagaagtggtaagattatgcgcagaattttgagaaagattcta
gcgggtgaagaagatcagttgggtgacatttctacgctctccgatccaagtgtagtcgag
aaaatcatcaatatagttcacagcgcaagaaagtag

DBGET integrated database retrieval system