KEGG   Botrytis cinerea: BC1G_07090Help
Entry
BC1G_07090        CDS       T01072                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfu  Botrytis cinerea
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_07090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_07090
   00620 Pyruvate metabolism
    BC1G_07090
   00640 Propanoate metabolism
    BC1G_07090
  Energy metabolism
   00680 Methane metabolism
    BC1G_07090
Enzymes [BR:bfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1G_07090
Lipid biosynthesis proteins [BR:bfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1G_07090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 651 aa AA seqDB search
MSEGKVKPSTPVVAEAHDVDTFRLDEYKKLYNESIKEPNKFWGRMARELLTWQKDFETVH
SGSFVGGDNAWFLEGQLNASFNCVDRHAIKNPDKPAIIYEADEASDGRTLTYSELLREVC
KTAYVLKQMGVKKGDTVAIYLPMIPEAVIAFLACSRIGAVHSVVFAGFSSDSLRDRVIDA
QSKVVITSDEGKRGGKLIGTKKIVDDALKQCPDVTHCLVYRRTGADVPMTEGRDWWWHEE
VEKWPSYIAPEPMNSEDPLFLLYTSGSTGKPKGVMHSTAGYLLGAAATGKYVFDIHDSDK
FFCGGDVGWITGHTYVVYAPLLLGVATVVFEGTPAYPNFSRYWDVIEKHEVTQFYVAPTA
LRLLKRAGDQHVKAQMKHLRVLGSVGEPIAAEVWKWYFEIVGKEEAHVVDTYWQTETGSN
VITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEGVLAFKQPWPSMARTVWG
AHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNVSGHRLSTAEIEAALIEH
HAVAEAAVVGINDELTGQAVNAFVAIKDGNEVNDSLKKDLILQVRKSIGPFAAPKAVFVV
PDLPKTRSGKIMRRILRKILAGEEDQLGDISTLSDPSVVEKIINIVHSARK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggaaaggtaaagccatctactcccgtagtagcagaagctcatgatgtcgat
acattccgactcgacgaatacaagaaactctacaatgaatcaatcaaagagcccaacaag
ttttggggaagaatggcccgtgaacttcttacctggcaaaaagatttcgagactgtacac
agcggatcgtttgtgggcggtgacaatgcctggttcttggagggtcaattaaatgcttca
ttcaattgtgttgatcgccatgcgatcaagaacccagacaagccagctatcatttacgaa
gccgatgaagctagcgatggtcgcactctcacatatagcgaacttctgcgagaagtttgc
aaaaccgcatatgttctcaaacaaatgggtgttaagaagggggacactgttgcgatttat
ctgcctatgattccagaagctgttattgctttcttggcttgttcgcgtattggtgcagtt
cactctgtagtctttgccggtttctcatccgattcccttcgagacagagttattgatgct
cagtcgaaagttgtgattacgtcggatgagggcaagcgtggtggaaaactcattggcaca
aagaagattgtggatgatgcgctgaaacaatgtcccgatgtcacgcactgtttggtttac
agacgtaccggtgccgacgttccaatgaccgaaggacgtgattggtggtggcatgaggag
gtcgagaaatggccatcttacattgctccagagccaatgaactccgaggatccattgttc
ttactttatacctctggatcaactggaaaaccaaagggtgttatgcactcaaccgctggt
tatcttttaggtgcggcagctactggaaagtatgtattcgatattcacgactcagataaa
ttcttctgtggcggtgatgttggatggattactggtcatacatatgtagtttatgcccct
cttcttcttggtgttgcaactgttgtgttcgaaggaactccagcatatccaaatttctcc
agatattgggatgttattgagaagcacgaggtcacacaattctatgttgcgcctacagcg
ctcagattattgaagcgtgccggtgatcaacatgtcaaggcacaaatgaagcacttgaga
gtattgggatcagttggtgaaccaattgctgccgaggtctggaaatggtatttcgagatt
gttggaaaggaagaagctcacgttgttgacacctactggcaaactgagaccggttccaat
gtcattactcctctcgcaggtgttacccctaccaagcctggtagtgcatcacttccattt
tttggtatcgagcctgcgattatcgaccctgtctccggagaagaaattcacggaaatgat
gtcgagggtgtattggctttcaagcaaccatggcccagtatggctcgtaccgtttgggga
gcacacaagagatatatggatacatatttgaacgtctacaaggggtactacttcactggt
gatggagcaggacgtgatcacgaaggttactactggatccgaggccgtgttgacgacgtt
gtcaacgtcagcggtcatcgtctctctaccgccgaaattgaagctgctttgattgagcat
catgctgttgccgaagctgcagtcgttggtatcaacgatgagcttactggacaagcagtc
aatgctttcgtcgctattaaggacggtaatgaggttaacgattcactgaagaaggatctc
atcttacaagtccgaaagagtatcggtccattcgcagctccaaaggcagtatttgttgtt
ccagatttgccaaagactagaagtggtaagattatgcgcagaattttgagaaagattcta
gcgggtgaagaagatcagttgggtgacatttctacgctctccgatccaagtgtagtcgag
aaaatcatcaatatagttcacagcgcaagaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system