KEGG   Botryotinia fuckeliana: BC1G_07090Help
Entry
BC1G_07090        CDS       T01072                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bfu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bfu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bfu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bfu00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 651 aa AA seqDB search
MSEGKVKPSTPVVAEAHDVDTFRLDEYKKLYNESIKEPNKFWGRMARELLTWQKDFETVH
SGSFVGGDNAWFLEGQLNASFNCVDRHAIKNPDKPAIIYEADEASDGRTLTYSELLREVC
KTAYVLKQMGVKKGDTVAIYLPMIPEAVIAFLACSRIGAVHSVVFAGFSSDSLRDRVIDA
QSKVVITSDEGKRGGKLIGTKKIVDDALKQCPDVTHCLVYRRTGADVPMTEGRDWWWHEE
VEKWPSYIAPEPMNSEDPLFLLYTSGSTGKPKGVMHSTAGYLLGAAATGKYVFDIHDSDK
FFCGGDVGWITGHTYVVYAPLLLGVATVVFEGTPAYPNFSRYWDVIEKHEVTQFYVAPTA
LRLLKRAGDQHVKAQMKHLRVLGSVGEPIAAEVWKWYFEIVGKEEAHVVDTYWQTETGSN
VITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEGVLAFKQPWPSMARTVWG
AHKRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNVSGHRLSTAEIEAALIEH
HAVAEAAVVGINDELTGQAVNAFVAIKDGNEVNDSLKKDLILQVRKSIGPFAAPKAVFVV
PDLPKTRSGKIMRRILRKILAGEEDQLGDISTLSDPSVVEKIINIVHSARK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggaaaggtaaagccatctactcccgtagtagcagaagctcatgatgtcgat
acattccgactcgacgaatacaagaaactctacaatgaatcaatcaaagagcccaacaag
ttttggggaagaatggcccgtgaacttcttacctggcaaaaagatttcgagactgtacac
agcggatcgtttgtgggcggtgacaatgcctggttcttggagggtcaattaaatgcttca
ttcaattgtgttgatcgccatgcgatcaagaacccagacaagccagctatcatttacgaa
gccgatgaagctagcgatggtcgcactctcacatatagcgaacttctgcgagaagtttgc
aaaaccgcatatgttctcaaacaaatgggtgttaagaagggggacactgttgcgatttat
ctgcctatgattccagaagctgttattgctttcttggcttgttcgcgtattggtgcagtt
cactctgtagtctttgccggtttctcatccgattcccttcgagacagagttattgatgct
cagtcgaaagttgtgattacgtcggatgagggcaagcgtggtggaaaactcattggcaca
aagaagattgtggatgatgcgctgaaacaatgtcccgatgtcacgcactgtttggtttac
agacgtaccggtgccgacgttccaatgaccgaaggacgtgattggtggtggcatgaggag
gtcgagaaatggccatcttacattgctccagagccaatgaactccgaggatccattgttc
ttactttatacctctggatcaactggaaaaccaaagggtgttatgcactcaaccgctggt
tatcttttaggtgcggcagctactggaaagtatgtattcgatattcacgactcagataaa
ttcttctgtggcggtgatgttggatggattactggtcatacatatgtagtttatgcccct
cttcttcttggtgttgcaactgttgtgttcgaaggaactccagcatatccaaatttctcc
agatattgggatgttattgagaagcacgaggtcacacaattctatgttgcgcctacagcg
ctcagattattgaagcgtgccggtgatcaacatgtcaaggcacaaatgaagcacttgaga
gtattgggatcagttggtgaaccaattgctgccgaggtctggaaatggtatttcgagatt
gttggaaaggaagaagctcacgttgttgacacctactggcaaactgagaccggttccaat
gtcattactcctctcgcaggtgttacccctaccaagcctggtagtgcatcacttccattt
tttggtatcgagcctgcgattatcgaccctgtctccggagaagaaattcacggaaatgat
gtcgagggtgtattggctttcaagcaaccatggcccagtatggctcgtaccgtttgggga
gcacacaagagatatatggatacatatttgaacgtctacaaggggtactacttcactggt
gatggagcaggacgtgatcacgaaggttactactggatccgaggccgtgttgacgacgtt
gtcaacgtcagcggtcatcgtctctctaccgccgaaattgaagctgctttgattgagcat
catgctgttgccgaagctgcagtcgttggtatcaacgatgagcttactggacaagcagtc
aatgctttcgtcgctattaaggacggtaatgaggttaacgattcactgaagaaggatctc
atcttacaagtccgaaagagtatcggtccattcgcagctccaaaggcagtatttgttgtt
ccagatttgccaaagactagaagtggtaagattatgcgcagaattttgagaaagattcta
gcgggtgaagaagatcagttgggtgacatttctacgctctccgatccaagtgtagtcgag
aaaatcatcaatatagttcacagcgcaagaaagtag

DBGET integrated database retrieval system