KEGG   Botrytis cinerea: BC1G_07193Help
Entry
BC1G_07193        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bfu  Botrytis cinerea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1G_07193
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BC1G_07193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 280 aa AA seqDB search
MADVIKKIPGGSQFMLFLGDFIYIDVPKRFGVSVEDYRREYRQVYSSPDWPAVGQNLSWI
HVLDDHEIANDWDKKTAGTCQIYEAAADPWHHYQTAVNPPRARQAGTYNTLRDGATYFEF
TQGPASFFLMDTRTYRDPSSELPANSTGKSMLGAEQLADLLDFLKKPEPKGRVNSMDTWA
GYLNERQVILEAMWDVGLRGGCGVVIISGDRHEFAATAFPPPLNGRGNSKLGAITIEDTA
SDQSTLKFRLYVDGHEVWSSLLLSPPAVPGGRWTKEAFWR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtcatcaaaaagattcctggaggctcccagttcatgctgtttcttggcgac
ttcatttacattgatgtcccgaagaggtttggagtgagtgtggaggactatcgccgcgag
tacagacaagtttacagctctccagattggccagccgttgggcaaaatctaagctggata
cacgtgctcgatgatcacgagattgccaatgattgggataaaaagactgccgggacttgt
cagatttatgaagccgccgctgatccatggcatcattatcaaacggccgtcaatccccct
cgagctcgccaagcgggtacttataacactctcagagacggtgctacttacttcgagttt
acccaagggcctgcttctttcttcttgatggataccagaacttaccgagatccttcttcg
gagctccccgccaacagcactggaaagtcaatgcttggtgcagaacagcttgctgatctc
ctcgactttcttaaaaagccggagccaaaaggtcgggtgaatagtatggatacatgggct
ggctacctcaacgagcgccaggtaattctcgaagctatgtgggatgtaggcctccgtgga
ggctgtggggtcgtcatcatcagtggagatagacatgaatttgccgcaacagcctttccg
cctcccttgaatggtcgcggtaattcaaaattgggagcgatcacaattgaagacactgct
agcgaccaaagtactctaaaattccgcctgtatgtagatggtcatgaggtttggtcttcc
ctccttctctcaccacctgctgttcccgggggtcgctggaccaaggaagctttttggagg
taa

DBGET integrated database retrieval system