KEGG   Botryotinia fuckeliana: BC1G_07193Help
Entry
BC1G_07193        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 280 aa AA seqDB search
MADVIKKIPGGSQFMLFLGDFIYIDVPKRFGVSVEDYRREYRQVYSSPDWPAVGQNLSWI
HVLDDHEIANDWDKKTAGTCQIYEAAADPWHHYQTAVNPPRARQAGTYNTLRDGATYFEF
TQGPASFFLMDTRTYRDPSSELPANSTGKSMLGAEQLADLLDFLKKPEPKGRVNSMDTWA
GYLNERQVILEAMWDVGLRGGCGVVIISGDRHEFAATAFPPPLNGRGNSKLGAITIEDTA
SDQSTLKFRLYVDGHEVWSSLLLSPPAVPGGRWTKEAFWR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtcatcaaaaagattcctggaggctcccagttcatgctgtttcttggcgac
ttcatttacattgatgtcccgaagaggtttggagtgagtgtggaggactatcgccgcgag
tacagacaagtttacagctctccagattggccagccgttgggcaaaatctaagctggata
cacgtgctcgatgatcacgagattgccaatgattgggataaaaagactgccgggacttgt
cagatttatgaagccgccgctgatccatggcatcattatcaaacggccgtcaatccccct
cgagctcgccaagcgggtacttataacactctcagagacggtgctacttacttcgagttt
acccaagggcctgcttctttcttcttgatggataccagaacttaccgagatccttcttcg
gagctccccgccaacagcactggaaagtcaatgcttggtgcagaacagcttgctgatctc
ctcgactttcttaaaaagccggagccaaaaggtcgggtgaatagtatggatacatgggct
ggctacctcaacgagcgccaggtaattctcgaagctatgtgggatgtaggcctccgtgga
ggctgtggggtcgtcatcatcagtggagatagacatgaatttgccgcaacagcctttccg
cctcccttgaatggtcgcggtaattcaaaattgggagcgatcacaattgaagacactgct
agcgaccaaagtactctaaaattccgcctgtatgtagatggtcatgaggtttggtcttcc
ctccttctctcaccacctgctgttcccgggggtcgctggaccaaggaagctttttggagg
taa

DBGET integrated database retrieval system