KEGG   Botrytis cinerea: BC1G_07203Help
Entry
BC1G_07203        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BC1G_07203
Peptidases [BR:bfu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BC1G_07203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 805 aa AA seqDB search
MSRWLEMNLSNKQASNESHPIPRAQSAAVEGGKNNSERRKELISIDADIQSPENMIVDPD
EYVEPSDNEKDDIAIIDPDEPRPTPADDYEAIRELVLPPLDQQPPIIETVHHTWEIKNWQ
GLQKREHGPIFHAGGYPCDNVSFYLEHGFEDGPPDDFVCCLQFGLVLWNPNDPTLYTYHT
AHHRFTKEEGDWGFTRFVETRKLHAHVWPGSNPPRPLVESGEANMTAYAVYQIPTQDEDT
TTNSAYTLQRLFYQLQSSSAAVSTNELTKSFGWDTKQIFEQQDVQELSRKLMEVMEKRMK
GTEAENVLPKLFCGKVRTYISCINVDYESRRVEDFWDVQLNVSGNKDIEASFRDYIQVET
MDGDNQYFAGENYKLQDAKKGVIFESFPEVLHLQLKRFEYDIERDSMMKVNDRYEFPDTF
DAAPYLSDDADRSESWIYKLHGVLVHSGDLNAGHYYAFIKPEKDGWFYKYDDDKVTKATM
REVLEDNYGGEMPLLNGQVYDASQKPIIRHNSAYMLVYIREARLDEVLLPVTNADTPAHL
QRKLEEEAAFKEARRKEREEQHLYLTVRVITQETYAAHGGHDLTVFDRSHDEDPAAAKSY
KLLKKCTIRELIKVIGKDTGTDPRRLRVWFMVNRQNKTTRPDTPVLDYDQTIEEAHLKLA
GSKTQELRLWAETAETVDSNGDAVWPAHPLVKEGSSPSRSDEIVIFLKWFNVDTQSLVGC
GHIYISSQSKVEELAPFILKRMNWPEDTRLKLYEEIKPDMIEPMKAKQSLKAAELQDGDI
VCFQRASEGSSGSDGSDTTTMVSNG
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatggctagagatgaacttatccaacaagcaagcaagcaacgaatcccatccc
atcccacgagcacaatctgccgctgtcgagggaggcaagaacaactccgagcgaaggaag
gaactcatttctatcgatgcagacatacaatcccccgagaatatgattgttgacccggac
gagtatgtcgaaccatcagacaatgagaaggatgacatcgccatcatagatccggatgag
cccaggccaacgcctgctgatgattatgaagctataagagagctggtattgccaccgctg
gatcaacaacccccgatcatagagacggttcatcatacttgggagattaaaaattggcaa
gggctccaaaagagagaacatggtccaatctttcatgcggggggatatccatgcgataat
gtgtccttctacctggagcacggatttgaggatgggcctccagacgactttgtatgctgt
ttacaattcggcctcgttctatggaatccgaatgatccaacgctttacacttaccacacc
gcgcatcatcgatttaccaaagaggaaggggactggggctttactcgattcgttgaaacc
cgcaagcttcatgctcatgtatggcctggatccaaccccccgaggccgttggttgagagc
ggagaagcaaatatgacagcatatgcagtatatcaaattccaacgcaagacgaggacacc
accacaaacagcgcatatactctacaacgcctcttttatcagctgcagtcatcttctgca
gctgtgagtaccaacgagctcaccaagtcttttggctgggatacaaaacagatttttgaa
cagcaagatgttcaagagctttctaggaaattgatggaggttatggaaaagagaatgaag
gggactgaagctgaaaacgttctccctaaattgttttgcggaaaagtgcgaacctatatc
tcttgcataaatgtcgactacgaatctcgccgagtagaagatttttgggacgtccaactg
aatgttagcggtaacaaggacattgaagccagtttccgggattatattcaagtcgagaca
atggatggcgacaatcaatacttcgcaggtgaaaattacaaacttcaagatgcgaagaaa
ggtgtcatcttcgaatcgtttcccgaggttcttcatttgcagctcaagcgattcgaatat
gatattgagagagattccatgatgaaggtcaacgatcgttacgaatttccagatactttt
gatgccgcgccatatctgtcagatgatgcagatagatccgaatcttggatttataagctg
catggagttcttgtacacagcggcgatctcaatgcaggacattactatgcttttatcaag
cctgaaaaggatgggtggttctacaaatatgatgatgacaaagtaaccaaggccacaatg
cgagaagttttggaagacaattatggaggagagatgccccttttgaatgggcaagtttat
gatgcatcgcaaaaacctatcatacgacataacagcgcatatatgcttgtctacattcgc
gaggcaagactcgatgaggtattacttcccgtaaccaacgccgatacgccagctcatctc
caaagaaaacttgaagaggaggccgctttcaaagaagcacgacggaaggaacgtgaagaa
cagcacttataccttactgttagggtgattacccaggagacctacgcagctcatggtgga
catgatcttacagtatttgaccgaagccatgacgaggatcctgcggctgctaaatcttac
aaactcctcaagaagtgtactattagagagctcatcaaagtgattggtaaggatactgga
actgatccaagaagactacgagtctggttcatggtcaatcgtcaaaacaaaacaacaaga
cctgacacgcctgtcctggactacgatcaaaccattgaagaagctcacctaaagttagct
ggtagtaagacacaggagctgaggctttgggccgaaacagccgaaacagttgattccaat
ggtgatgcggtgtggccagctcatccgctggtgaaagaagggtcgtctccaagtagatct
gatgaaattgtcatatttctcaaatggttcaacgttgatacccagtctttagttggatgc
ggtcacatttatatcagtagccagagtaaagttgaagaactggccccgttcatcttaaaa
cgtatgaattggccagaggatactagattgaagctctacgaggagataaaaccagacatg
atcgaacctatgaaagcgaaacaatcactcaaggcagcagaactacaggatggcgatatt
gtttgtttccagagagcttcggaaggaagtagtggaagcgatggctcggataccactacc
atggtctccaatggttaa

DBGET integrated database retrieval system