KEGG   Botrytis cinerea: BC1G_07211Help
Entry
BC1G_07211        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bfu  Botrytis cinerea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1G_07211
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BC1G_07211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 503 aa AA seqDB search
MAPHLKVTLYESSERLGGWLRTKHIDVGDGEVVFEQGPRTLRPNTPAGFVTLNLIRDLGL
SDEVIKTNKLSAAALNRFVYYPDRLVCMPEPSQGIYAIAWKMLTEPVFKGMHRLLFEYKR
PRRPAELDDESVGSFLARRTGGTDIPDNLVSAVFHGIYAGDIYKLSAKSIMPSQWGMEGA
FGSISAGISQMAKFKNATAEDADLEEKERSSFTDNERAIINETSVYTFRRGIGTLSEALD
SSLRNNPNVKIKLGEDVGKIEYDGQSEGIKIYTAQAGESSTNHSYVISTLSGRTLSTLTT
PSDDSLLPSLAKTEAVTVMVVNLYYRDEDLLPERGFGYLIPRSIPFDQNPEFALGVVFDS
DATVGQDTVPGTKVTVMLGGHWWDDFETYPSEEEGAAMAKAVLKRHLKIDQEPEMVHASL
QKDCIPQYTVGHEQRLKQAHYELLSAYKGRLAVAGNSYTGVGVNDCIKAAKVVAGDVARS
NDVTGLEKFAEQKWWEKMIKREQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcaccacatttgaaagttacattgtatgagagtagtgagaggctaggagggtggctg
cggacaaaacatattgacgtgggagatggtgaagttgtgtttgaacaaggaccgaggact
ttgagaccgaacacgcctgcgggatttgttactctaaacttgattagagaccttggtctg
tctgacgaggtgattaaaaccaacaaattgtctgccgctgccttgaaccgctttgtctat
tatcccgatcggcttgtgtgcatgcctgagcctagccaaggaatttacgccattgcctgg
aaaatgttgacagaaccagttttcaaaggaatgcacaggctgcttttcgaatataagagg
ccacgaagaccagcagaattggatgacgaatccgtgggatcatttctggccagacgaaca
ggagggacagacattccagataatttggtgtcagccgtatttcacggtatctatgctggt
gatatctacaaactgagtgcaaaaagtataatgccctcccagtggggaatggagggggca
tttggaagtatcagtgcaggaatatctcaaatggcaaaattcaagaatgcgacagctgaa
gatgcagacctggaggaaaaggagagaagttcatttacggacaatgagagggcaattatc
aacgaaacaagtgtctatactttccgcagaggaattggcacactatctgaagcactcgat
tcctctctaaggaataatcctaacgtgaaaatcaagctgggcgaggacgtggggaaaatc
gagtacgatggacaaagtgaaggcatcaagatctacacagctcaggctggcgaatcatcc
accaaccattcttacgttatttctaccttgtcaggccgcaccctctctacactaactacc
ccttcagatgattctttactcccttcacttgcgaaaacagaggctgtgacagtcatggtt
gttaatctctactaccgggacgaagatctccttccggagcgcggttttggatacctaatc
ccacgatccattccttttgaccagaatccagagtttgctcttggtgtagtatttgattca
gacgcaacagttggtcaagatactgttccagggaccaaagtcaccgttatgttgggtggc
cattggtgggacgactttgaaacatatcccagcgaggaagagggtgctgcaatggcaaaa
gccgttctcaagcgacacctgaagattgaccaagaaccagaaatggtacatgcatctttg
cagaaagattgtattcctcaatatactgtgggtcatgagcagagactgaaacaagcgcat
tatgagttgttgagcgcatacaagggaagactggcagtagctggaaattcatacactggg
gtgggtgtgaatgattgcatcaaggctgctaaagtcgtggcaggcgatgttgcacgtagt
aatgacgttacgggactggaaaagttcgctgaacaaaaatggtgggagaaaatgatcaaa
cgagaacaataa

DBGET integrated database retrieval system