KEGG   Botrytis cinerea: BC1G_07211Help
Entry
BC1G_07211        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bfu  Botrytis cinerea
Pathway
bfu00860  Porphyrin and chlorophyll metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1G_07211
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BC1G_07211
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BC1G_07211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 5434590
NCBI-ProteinID: XP_001554074
AA seq 503 aa AA seqDB search
MAPHLKVTLYESSERLGGWLRTKHIDVGDGEVVFEQGPRTLRPNTPAGFVTLNLIRDLGL
SDEVIKTNKLSAAALNRFVYYPDRLVCMPEPSQGIYAIAWKMLTEPVFKGMHRLLFEYKR
PRRPAELDDESVGSFLARRTGGTDIPDNLVSAVFHGIYAGDIYKLSAKSIMPSQWGMEGA
FGSISAGISQMAKFKNATAEDADLEEKERSSFTDNERAIINETSVYTFRRGIGTLSEALD
SSLRNNPNVKIKLGEDVGKIEYDGQSEGIKIYTAQAGESSTNHSYVISTLSGRTLSTLTT
PSDDSLLPSLAKTEAVTVMVVNLYYRDEDLLPERGFGYLIPRSIPFDQNPEFALGVVFDS
DATVGQDTVPGTKVTVMLGGHWWDDFETYPSEEEGAAMAKAVLKRHLKIDQEPEMVHASL
QKDCIPQYTVGHEQRLKQAHYELLSAYKGRLAVAGNSYTGVGVNDCIKAAKVVAGDVARS
NDVTGLEKFAEQKWWEKMIKREQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcaccacatttgaaagttacattgtatgagagtagtgagaggctaggagggtggctg
cggacaaaacatattgacgtgggagatggtgaagttgtgtttgaacaaggaccgaggact
ttgagaccgaacacgcctgcgggatttgttactctaaacttgattagagaccttggtctg
tctgacgaggtgattaaaaccaacaaattgtctgccgctgccttgaaccgctttgtctat
tatcccgatcggcttgtgtgcatgcctgagcctagccaaggaatttacgccattgcctgg
aaaatgttgacagaaccagttttcaaaggaatgcacaggctgcttttcgaatataagagg
ccacgaagaccagcagaattggatgacgaatccgtgggatcatttctggccagacgaaca
ggagggacagacattccagataatttggtgtcagccgtatttcacggtatctatgctggt
gatatctacaaactgagtgcaaaaagtataatgccctcccagtggggaatggagggggca
tttggaagtatcagtgcaggaatatctcaaatggcaaaattcaagaatgcgacagctgaa
gatgcagacctggaggaaaaggagagaagttcatttacggacaatgagagggcaattatc
aacgaaacaagtgtctatactttccgcagaggaattggcacactatctgaagcactcgat
tcctctctaaggaataatcctaacgtgaaaatcaagctgggcgaggacgtggggaaaatc
gagtacgatggacaaagtgaaggcatcaagatctacacagctcaggctggcgaatcatcc
accaaccattcttacgttatttctaccttgtcaggccgcaccctctctacactaactacc
ccttcagatgattctttactcccttcacttgcgaaaacagaggctgtgacagtcatggtt
gttaatctctactaccgggacgaagatctccttccggagcgcggttttggatacctaatc
ccacgatccattccttttgaccagaatccagagtttgctcttggtgtagtatttgattca
gacgcaacagttggtcaagatactgttccagggaccaaagtcaccgttatgttgggtggc
cattggtgggacgactttgaaacatatcccagcgaggaagagggtgctgcaatggcaaaa
gccgttctcaagcgacacctgaagattgaccaagaaccagaaatggtacatgcatctttg
cagaaagattgtattcctcaatatactgtgggtcatgagcagagactgaaacaagcgcat
tatgagttgttgagcgcatacaagggaagactggcagtagctggaaattcatacactggg
gtgggtgtgaatgattgcatcaaggctgctaaagtcgtggcaggcgatgttgcacgtagt
aatgacgttacgggactggaaaagttcgctgaacaaaaatggtgggagaaaatgatcaaa
cgagaacaataa

DBGET integrated database retrieval system