KEGG   Botryotinia fuckeliana: BC1G_07215Help
Entry
BC1G_07215        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfu  Botryotinia fuckeliana
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfu00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:bfu00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:bfu00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bfu00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 599 aa AA seqDB search
MRSSTFLISALVSSALAIWPQPVSYTNGTGVLWLDKNVKVTYDGGAVRSFLPKFYVMNTE
KLLAVQSTGYSSSGTGNITTSKTIVSKAVTRAMNKIFHQGLTPWKLYPRNALPLVEPSAT
SNKSYISEILITQTGQDNSSTFKPTDGQVDESYNLTITTDGKASISAPSSIGILHALTTF
TQLFYTHSVAKAGVYTKLAPVTIYDAPKFAHRGLNMDISRNWYPVEDIKRTMLAMHYTKC
SVIHLHITDAQSWPLDIPALPELSKLGAYATGLSYTPADLKEIQEYGVELGIEVILEIDM
PGHTSSIGYSHPELMAALFAEPWDTYCAEPPCGSLRLNDSAVPAFLEKLFDDLLPRVSPY
SSYFHTGGDEVNVNTYLLDPTVQSNDTAVLTPLIQAFVDRNHKQVRAAGLTPMVWEEMIT
TWNLTLGSDVLVQSWLSDASVAQIVAAGHKAIAGNYNFWYLDCGKGQWLNFEPGASSEKY
FPYNDYCSPTKSWRLVYSYDPLAGVPENSTHLVVGGEFHIWSEQTDPINLDDMVWPRGAA
AAEVLWSGAKDPVTGQNRSQIDAGSRLPEFNEHLRSLGIRSGPVQMIYCTQLNSTTCAL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcttctacctttctaatatctgctttggtctcctctgcgttggctatttggcct
caacctgtttcgtatacaaatggtactggtgttttgtggttggataagaacgttaaggtt
acttatgatggcggtgctgtacgatcattccttccaaaattttatgttatgaatactgag
aaattgctcgctgtacagtctacaggatattctagtagtggaactggaaatataacaact
agcaagacgattgtttctaaggccgtaactcgagctatgaacaagatcttccaccaaggt
ttgacaccatggaaattatatccacgaaatgccctgcccttagttgagccatcggccacc
tcaaacaagagctatatcagcgagattctcatcacccagaccggacaagataactcctcc
acattcaagcctacggacggtcaggttgacgagtcatacaacctcacaatcactactgat
ggaaaggcctctatcagcgctccctcatctattggcatccttcatgcactgaccacgttc
acacaactcttctacacacattctgttgctaaagctggcgtctacacaaaattagctccc
gtgacaatttacgatgcgccaaaatttgcacaccgtggactcaatatggatatatcccga
aactggtatcctgttgaggatatcaagaggacaatgttagcaatgcattacactaaatgc
agtgtcattcatttacacatcaccgatgctcagtcgtggcctttggatatcccagcactt
cccgaattgtcaaagttgggtgcttatgcgaccggattatcctatacccccgcagacctt
aaggaaattcaagagtatggcgttgagcttggtatcgaagttatcttggagattgatatg
cctggtcacacaagctccattggatattctcaccctgagctcatggcagccttgttcgcc
gaaccttgggatacttactgtgctgaacctccttgtggatcattgagactcaatgattca
gccgtaccagcattccttgagaaattgtttgatgatcttcttcctagagtctctccatac
tcgtcatacttccataccggtggagatgaagttaatgttaatacttatttgttggacccc
actgttcaatcgaatgataccgccgttctcacaccattaatccaagcattcgtggacaga
aaccacaaacaagtcagagctgccggacttaccccaatggtctgggaagaaatgatcaca
acatggaacctcactttgggatctgatgttctcgttcaatcatggctcagtgatgcctct
gtcgctcaaattgtcgcggctggacataaagctattgctggcaattataacttctggtat
ctcgactgtggcaaaggacagtggctcaattttgagccaggtgcatcctctgagaaatac
ttcccctacaatgattattgttcgcctaccaagagttggcgcttagtctactcctacgat
cctctcgctggggtacccgaaaactcaactcatttggttgttggcggagaatttcacatt
tggtctgagcaaaccgatccaatcaaccttgacgatatggtatggccaagaggagctgcc
gccgcagaagtattgtggtcaggcgccaaggatccagtcactggacagaacagaagtcaa
atcgacgcaggcagcagattgccagaattcaatgaacacttgagatctttgggaatcaga
tcaggacctgtacaaatgatttactgcacacaactcaactcgacaacatgcgcattgtag

DBGET integrated database retrieval system