KEGG   Botrytis cinerea: BC1G_07215Help
Entry
BC1G_07215        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfu  Botrytis cinerea
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BC1G_07215
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    BC1G_07215
   00603 Glycosphingolipid biosynthesis - globo series
    BC1G_07215
   00604 Glycosphingolipid biosynthesis - ganglio series
    BC1G_07215
   00511 Other glycan degradation
    BC1G_07215
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BC1G_07215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 599 aa AA seqDB search
MRSSTFLISALVSSALAIWPQPVSYTNGTGVLWLDKNVKVTYDGGAVRSFLPKFYVMNTE
KLLAVQSTGYSSSGTGNITTSKTIVSKAVTRAMNKIFHQGLTPWKLYPRNALPLVEPSAT
SNKSYISEILITQTGQDNSSTFKPTDGQVDESYNLTITTDGKASISAPSSIGILHALTTF
TQLFYTHSVAKAGVYTKLAPVTIYDAPKFAHRGLNMDISRNWYPVEDIKRTMLAMHYTKC
SVIHLHITDAQSWPLDIPALPELSKLGAYATGLSYTPADLKEIQEYGVELGIEVILEIDM
PGHTSSIGYSHPELMAALFAEPWDTYCAEPPCGSLRLNDSAVPAFLEKLFDDLLPRVSPY
SSYFHTGGDEVNVNTYLLDPTVQSNDTAVLTPLIQAFVDRNHKQVRAAGLTPMVWEEMIT
TWNLTLGSDVLVQSWLSDASVAQIVAAGHKAIAGNYNFWYLDCGKGQWLNFEPGASSEKY
FPYNDYCSPTKSWRLVYSYDPLAGVPENSTHLVVGGEFHIWSEQTDPINLDDMVWPRGAA
AAEVLWSGAKDPVTGQNRSQIDAGSRLPEFNEHLRSLGIRSGPVQMIYCTQLNSTTCAL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcttctacctttctaatatctgctttggtctcctctgcgttggctatttggcct
caacctgtttcgtatacaaatggtactggtgttttgtggttggataagaacgttaaggtt
acttatgatggcggtgctgtacgatcattccttccaaaattttatgttatgaatactgag
aaattgctcgctgtacagtctacaggatattctagtagtggaactggaaatataacaact
agcaagacgattgtttctaaggccgtaactcgagctatgaacaagatcttccaccaaggt
ttgacaccatggaaattatatccacgaaatgccctgcccttagttgagccatcggccacc
tcaaacaagagctatatcagcgagattctcatcacccagaccggacaagataactcctcc
acattcaagcctacggacggtcaggttgacgagtcatacaacctcacaatcactactgat
ggaaaggcctctatcagcgctccctcatctattggcatccttcatgcactgaccacgttc
acacaactcttctacacacattctgttgctaaagctggcgtctacacaaaattagctccc
gtgacaatttacgatgcgccaaaatttgcacaccgtggactcaatatggatatatcccga
aactggtatcctgttgaggatatcaagaggacaatgttagcaatgcattacactaaatgc
agtgtcattcatttacacatcaccgatgctcagtcgtggcctttggatatcccagcactt
cccgaattgtcaaagttgggtgcttatgcgaccggattatcctatacccccgcagacctt
aaggaaattcaagagtatggcgttgagcttggtatcgaagttatcttggagattgatatg
cctggtcacacaagctccattggatattctcaccctgagctcatggcagccttgttcgcc
gaaccttgggatacttactgtgctgaacctccttgtggatcattgagactcaatgattca
gccgtaccagcattccttgagaaattgtttgatgatcttcttcctagagtctctccatac
tcgtcatacttccataccggtggagatgaagttaatgttaatacttatttgttggacccc
actgttcaatcgaatgataccgccgttctcacaccattaatccaagcattcgtggacaga
aaccacaaacaagtcagagctgccggacttaccccaatggtctgggaagaaatgatcaca
acatggaacctcactttgggatctgatgttctcgttcaatcatggctcagtgatgcctct
gtcgctcaaattgtcgcggctggacataaagctattgctggcaattataacttctggtat
ctcgactgtggcaaaggacagtggctcaattttgagccaggtgcatcctctgagaaatac
ttcccctacaatgattattgttcgcctaccaagagttggcgcttagtctactcctacgat
cctctcgctggggtacccgaaaactcaactcatttggttgttggcggagaatttcacatt
tggtctgagcaaaccgatccaatcaaccttgacgatatggtatggccaagaggagctgcc
gccgcagaagtattgtggtcaggcgccaaggatccagtcactggacagaacagaagtcaa
atcgacgcaggcagcagattgccagaattcaatgaacacttgagatctttgggaatcaga
tcaggacctgtacaaatgatttactgcacacaactcaactcgacaacatgcgcattgtag

DBGET integrated database retrieval system