KEGG   Botryotinia fuckeliana: BC1G_07401Help
Entry
BC1G_07401        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01886  
glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
bfu  Botryotinia fuckeliana
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bfu00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 335 aa AA seqDB search
MADAITEGTAKLQLDEETGEMVSKAELKKRLAKRAKKAAQAKAKSAAPPKEAAATKPKKP
EETKAAEPSNVFAQGFLSEVYKERPVKPVFTRFPPEPNGYLHIGHAKAIAVNFGFAKYHG
GQCYLRFDDTNPEAEEEKYFTAIKEMVSWLGFTPYKITHSSDNFDKLYEKAEELINLGGA
YVCHCGDAEIKAQRGGEARGPRFRCEHANQSIEENLRKFRAMRDGEYKPREAFLRMKQNI
EDGNPQMWDLAAYRVLDAKHHLTGDKWKIYPTYDFTHCLCDSFENITHSLCTTEFILSRV
SFQAMRVAYMAMDSDSTDDKIILNRIVSLKEDAGK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcaattaccgaaggaacggccaagctccagcttgatgaggagacaggtgag
atggtctcgaaggccgaactgaagaagagattggcaaaacgtgcgaagaaagcagcacaa
gcaaaagcaaaatcagcagcaccacctaaagaagctgctgcaactaaacctaagaagcca
gaagagaccaaagcagcagagccatcaaatgtattcgcccaaggatttctctcagaagtg
tacaaggagcgtcctgtcaaaccagtctttacccgatttccacctgaacccaatggatac
ttgcatatcggtcatgcaaaagctattgctgtcaatttcggatttgctaagtatcatggc
ggtcagtgttatctgagatttgatgacaccaatcccgaagcagaggaagagaaatatttt
acagcgataaaagaaatggtttcgtggttgggcttcacaccttacaagattacacattcc
agcgataatttcgataaactttatgagaaggcagaggagcttatcaacttagggggggct
tatgtttgccactgtggtgatgctgaaatcaaagctcagagaggaggtgaagcacggggt
ccgagatttagatgcgagcatgcgaaccaatcgatcgaagaaaatttgagaaagtttaga
gccatgcgagatggcgaatacaaacctagggaggcattcttgcgcatgaagcagaacatt
gaagatggaaaccctcaaatgtgggatttggcagcatatcgagtcttggatgctaaacat
catctaacgggagataaatggaagatttatccaacatacgacttcactcattgtctttgc
gatagttttgagaacatcacacactcgctttgcacgaccgagttcattctatcaagagta
tcattccaggccatgcgtgtagcatacatggcaatggattcggactcaacggatgataag
attatattgaatcgcattgttagtttgaaggaggatgctggaaagtag

DBGET integrated database retrieval system