KEGG   Botrytis cinerea: BC1G_07401Help
Entry
BC1G_07401        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01886  
glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
bfu  Botrytis cinerea
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BC1G_07401
Enzymes [BR:bfu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     BC1G_07401
Amino acid related enzymes [BR:bfu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BC1G_07401
Transfer RNA biogenesis [BR:bfu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BC1G_07401
 Prokaryotic Type
   Other AARSs
    BC1G_07401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 335 aa AA seqDB search
MADAITEGTAKLQLDEETGEMVSKAELKKRLAKRAKKAAQAKAKSAAPPKEAAATKPKKP
EETKAAEPSNVFAQGFLSEVYKERPVKPVFTRFPPEPNGYLHIGHAKAIAVNFGFAKYHG
GQCYLRFDDTNPEAEEEKYFTAIKEMVSWLGFTPYKITHSSDNFDKLYEKAEELINLGGA
YVCHCGDAEIKAQRGGEARGPRFRCEHANQSIEENLRKFRAMRDGEYKPREAFLRMKQNI
EDGNPQMWDLAAYRVLDAKHHLTGDKWKIYPTYDFTHCLCDSFENITHSLCTTEFILSRV
SFQAMRVAYMAMDSDSTDDKIILNRIVSLKEDAGK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcaattaccgaaggaacggccaagctccagcttgatgaggagacaggtgag
atggtctcgaaggccgaactgaagaagagattggcaaaacgtgcgaagaaagcagcacaa
gcaaaagcaaaatcagcagcaccacctaaagaagctgctgcaactaaacctaagaagcca
gaagagaccaaagcagcagagccatcaaatgtattcgcccaaggatttctctcagaagtg
tacaaggagcgtcctgtcaaaccagtctttacccgatttccacctgaacccaatggatac
ttgcatatcggtcatgcaaaagctattgctgtcaatttcggatttgctaagtatcatggc
ggtcagtgttatctgagatttgatgacaccaatcccgaagcagaggaagagaaatatttt
acagcgataaaagaaatggtttcgtggttgggcttcacaccttacaagattacacattcc
agcgataatttcgataaactttatgagaaggcagaggagcttatcaacttagggggggct
tatgtttgccactgtggtgatgctgaaatcaaagctcagagaggaggtgaagcacggggt
ccgagatttagatgcgagcatgcgaaccaatcgatcgaagaaaatttgagaaagtttaga
gccatgcgagatggcgaatacaaacctagggaggcattcttgcgcatgaagcagaacatt
gaagatggaaaccctcaaatgtgggatttggcagcatatcgagtcttggatgctaaacat
catctaacgggagataaatggaagatttatccaacatacgacttcactcattgtctttgc
gatagttttgagaacatcacacactcgctttgcacgaccgagttcattctatcaagagta
tcattccaggccatgcgtgtagcatacatggcaatggattcggactcaacggatgataag
attatattgaatcgcattgttagtttgaaggaggatgctggaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system