KEGG   Botrytis cinerea: BC1G_07542Help
Entry
BC1G_07542        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
bfu  Botrytis cinerea
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    BC1G_07542
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     BC1G_07542
Protein kinases [BR:bfu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   BC1G_07542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 336 aa AA seqDB search
MAETTTAAAEEERNLVAHFKEQKILPPDEIKKNPRKEGLGASSRNLSVRDFELVRTLGTG
TFARVWLVRLANPAEEDRDKVFALKVLRKVEVIKLKQVDHVNHERSVLSDVAGHPFITTL
ITSFSDHDSLYMLLDYCPGGEVFSYLRKAKRFDENTARFYAAEIVLILEFLHEQEGVAYR
DMKPENLLLDAEGHIKLVDFGFAKRLGNRYPPFWHSNPIEIYKQASSRIVSKPVSFPAEP
AISPAAKDIIRQFCTLDRSHRLGNISGGAARVKDHPFFQGVIWEDVYYRKYRGPIIPPLR
YPGDAQNFDLYPDEKEGREPYTEELAAKYDDCFKGF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaccacgacggctgcggctgaggaagaaagaaacttagtggctcacttcaaa
gagcagaaaatcctgccccccgatgaaatcaaaaaaaatccaaggaaagaagggttggga
gcaagttcgagaaatttgagcgtgcgagactttgagttggtgaggactttaggaactggc
acattcgctcgcgtctggcttgtacgccttgcgaatcctgctgaagaggatcgtgataag
gtttttgcgctgaaggtcctgcggaaagtcgaggtcatcaaacttaaacaggtcgaccat
gtcaatcacgagcgttcggttctttcagatgttgctggacatccttttattactacatta
attacttctttttctgatcacgattcactgtatatgctgcttgactactgccctggaggt
gaagtattctcctatctacgaaaagccaaacgattcgacgagaacacagctcgattttat
gccgcggaaatagttttgattcttgaatttttacatgaacaagaaggcgttgcatataga
gacatgaagccggagaacctgctgttggatgctgagggacacataaaattggtcgatttt
ggattcgcaaaacgtttaggaaacagatatccacccttttggcattcaaacccaattgag
atttataagcaagcttcgtctagaattgttagcaagccagtttctttccctgccgaacct
gccatttcacctgcggcaaaagatatcattcgccaattttgcacgctcgatcgatcacat
cgtctcggaaacatatccggtggcgctgcacgggtgaaagaccaccctttttttcaagga
gtgatctgggaagatgtatattacaggaaataccgtggtccgattataccccctttgaga
tatcctggcgatgctcaaaatttcgatttatatcccgatgaaaaagaaggaagagaacca
tacacagaggagctcgcggcaaaatacgatgattgtttcaagggtttttag

DBGET integrated database retrieval system