KEGG   Botrytis cinerea: BC1G_07633Help
Entry
BC1G_07633        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
bfu  Botrytis cinerea
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    BC1G_07633
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     BC1G_07633
Protein kinases [BR:bfu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   BC1G_07633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 604 aa AA seqDB search
MADNPQLDAMGPPSDSIDFALKDTPQQKPTDDQNNEAPTSPSSSKPPTIPSLRPASDSEG
IATMTASSTPLGMLQNARRPRPGPSIPGGGRSSQVGRQPGGGLPTSMAEKMKAFHASRQG
TPTQRPQLPATISSPGVPASPAIDGLSGGLQLPPNMRPPPQNFVSAPVIPKMKMGGGLSA
RRGLKLPGGLPPAPAAAPVIHGGGIDFANGTNFNISLDEVDTLEELGKGNYGTVYKVRHA
RPRMRKPGLGLAGNKSSTTDTDDGEVQSGGNTTGVVMAMKELRLELDEAKFAAIIMELDI
LHRCLSPYIIDFYGAFFQEGAVYICIEFMDGGSIDKIYGDGIPENVLRKITYATTQGLKT
LKDEHNIIHRDVKPTNILVNTQGQVKICDFGVSGNLVASIAKTNIGCQSYMAPERISGGG
ISQAGANPGGGTYSVQSDIWSLGLSVIECAMGRYPYPPETYNNIFSQLSAIVDGEPPDLP
AEGFSPTARNFVRGCLNKIPNMRPTYSDLLQHPWLAELSKPNTISEEDEEEEEDQADVGG
LSLEDDVKQDTSNGILTGTEDSEVAEWVKNAIERKKLGLMGTHAQPALHKAPLDTVSPLP
SPRE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcagataatccgcaactagatgcgatgggtcctcccagcgactcaatcgattttgct
cttaaagatacccctcaacaaaagcctacagatgaccaaaataacgaggctcctacatca
cctagttcttcgaaacctcctactataccatctcttcgacccgcatcagattcggagggg
atagctaccatgacagcatcttctacacctcttggtatgttgcagaatgcgagaaggcca
agacctggtccatcgataccaggaggaggtagatcttcgcaagtaggaagacaacctggt
ggtggtttacccacttccatggcagaaaaaatgaaagcatttcacgcatcaagacaaggc
acacctacacaacgaccacagttacccgcgacaatatcatcaccgggggtaccagcttca
cctgccatagatggattatctggagggctacaattaccacctaacatgcgacctccacca
caaaactttgtttctgctccggtaattccgaaaatgaaaatgggtggtggactaagcgca
agaagaggattgaaactacctggtggtctacctccagctccagctgctgcgccagttatt
catggaggtggtatcgattttgcaaatggtacaaatttcaacatatctttggatgaggtt
gataccttggaagaattgggcaaagggaattatggtaccgtttacaaagttcgacatgca
agaccacgaatgcgcaaacctggattgggtctcgcgggtaataaatcatctacaactgat
accgatgatggcgaagtacaatctggaggaaatacaactggtgtagtcatggcaatgaaa
gaacttcgactggaacttgacgaagctaaattcgcggcaatcattatggaattggatatc
ctgcatagatgtttgagtccttatattatcgacttttatggtgcattctttcaagaggga
gctgtttacatctgcatagagtttatggatggaggatcgattgataaaatttatggagat
ggtattcccgaaaatgtcttgaggaaaatcacctatgcaacaactcaaggtttaaaaacc
ctgaaagacgaacataacatcattcatcgagatgttaaaccgacgaatattctcgtgaat
acccaagggcaggtcaaaatttgtgattttggtgtctctggaaacttggtcgctagtatc
gcaaaaacgaatattggatgtcaatcatatatggcaccagaaagaatttcgggtggtgga
atatcacaagctggtgcaaatcctggaggtggaacttatagtgtgcaaagtgatatttgg
tccttgggattaagtgttattgagtgtgcaatgggaagatatccgtacccaccagagaca
tataataatatcttttcacaattaagtgcaattgtcgatggtgaaccacccgatcttcct
gcagaaggtttctccccgaccgcccgcaattttgttcgaggatgtctgaacaaaattcca
aatatgcgtcctacctacagtgatttacttcaacatccatggttggctgagctttcgaaa
ccaaacacaatttcggaagaagatgaagaggaagaggaagatcaggccgatgtgggtggt
ttaagtctggaagatgatgtaaaacaagatacatcaaatggtatcttgacaggcaccgaa
gactcggaggttgcagaatgggtgaaaaatgctattgagaggaagaagttgggtctcatg
ggtacacacgcgcaacctgccttacacaaggcgcctttggatacggttagtccgttgccg
agtccgagggagtaa

DBGET integrated database retrieval system