KEGG   Botrytis cinerea: BC1G_07639Help
Entry
BC1G_07639        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
bfu  Botrytis cinerea
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BC1G_07639
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     BC1G_07639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 262 aa AA seqDB search
MPSASSSKLSLRSQTSLEEPSRDDPSPESSKANDESKHHHHRDKLLSQVAEWLHSEKAKR
NSRKANKKDTKENEAQAENLSHRGIASKPRTMSDSSTSSALSLEKLQRILEDNMLDLGHN
QLPHLNSPKRQSRKRSLVRPSLKASPSSDTEYHEGDIVVPSCDVILDNSKTLAYSGGAGS
SMETTTLSNAKRAEKERKAWIQFKNEIVRLAHTLRLKGWRRVPLDRGHEIEVERLSGALT
NAVYVVTPPADLPPSASSGAFN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgccagttcctccaaactgtctctccgaagtcagactagcttagaagaacca
agtcgcgatgatccttccccggaatcctcaaaagccaatgatgaatcaaagcatcatcat
caccgcgataaacttctttctcaagttgcagagtggctgcactcggaaaaggcgaagaga
aattcccgaaaagcaaataaaaaggacaccaaggagaacgaggcgcaggctgagaatttg
tctcacagaggaatagcttcaaaaccaagaacaatgtctgatagttccacttcaagcgct
ctttctttagaaaagttgcagagaattttggaagataacatgttagatctcggtcacaat
caacttccgcacctcaattcccccaagcgacaatcgagaaaacgatcccttgttcgtcct
tcgctgaaagcttctccatcatccgataccgaatatcacgaaggagatattgtggttcca
tcttgtgatgtgattcttgataactcaaaaacgcttgcatacagtggtggcgctggatct
tccatggaaacaaccacattaagcaatgcgaaacgagccgaaaaggaaagaaaagcgtgg
attcagttcaagaatgaaattgtgagattggcacatacactcagattgaaaggatggaga
agagtcccattagatcgaggtcatgagattgaagtggaacgattaagtggtgctcttaca
aacgccgtttatgttgttactccgcctgcagatttaccaccatctgcgagtagtggagca
tttaattga

DBGET integrated database retrieval system