KEGG   Botryotinia fuckeliana: BC1G_07639Help
Entry
BC1G_07639        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
bfu  Botryotinia fuckeliana
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bfu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 262 aa AA seqDB search
MPSASSSKLSLRSQTSLEEPSRDDPSPESSKANDESKHHHHRDKLLSQVAEWLHSEKAKR
NSRKANKKDTKENEAQAENLSHRGIASKPRTMSDSSTSSALSLEKLQRILEDNMLDLGHN
QLPHLNSPKRQSRKRSLVRPSLKASPSSDTEYHEGDIVVPSCDVILDNSKTLAYSGGAGS
SMETTTLSNAKRAEKERKAWIQFKNEIVRLAHTLRLKGWRRVPLDRGHEIEVERLSGALT
NAVYVVTPPADLPPSASSGAFN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgccagttcctccaaactgtctctccgaagtcagactagcttagaagaacca
agtcgcgatgatccttccccggaatcctcaaaagccaatgatgaatcaaagcatcatcat
caccgcgataaacttctttctcaagttgcagagtggctgcactcggaaaaggcgaagaga
aattcccgaaaagcaaataaaaaggacaccaaggagaacgaggcgcaggctgagaatttg
tctcacagaggaatagcttcaaaaccaagaacaatgtctgatagttccacttcaagcgct
ctttctttagaaaagttgcagagaattttggaagataacatgttagatctcggtcacaat
caacttccgcacctcaattcccccaagcgacaatcgagaaaacgatcccttgttcgtcct
tcgctgaaagcttctccatcatccgataccgaatatcacgaaggagatattgtggttcca
tcttgtgatgtgattcttgataactcaaaaacgcttgcatacagtggtggcgctggatct
tccatggaaacaaccacattaagcaatgcgaaacgagccgaaaaggaaagaaaagcgtgg
attcagttcaagaatgaaattgtgagattggcacatacactcagattgaaaggatggaga
agagtcccattagatcgaggtcatgagattgaagtggaacgattaagtggtgctcttaca
aacgccgtttatgttgttactccgcctgcagatttaccaccatctgcgagtagtggagca
tttaattga

DBGET integrated database retrieval system