KEGG   Botryotinia fuckeliana: BC1G_07822Help
Entry
BC1G_07822        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bfu  Botryotinia fuckeliana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 599 aa AA seqDB search
MKTAAIFSVLSLAVDTTSATSIPTTSTTSKPITSTTSSSKTSSAATSTVQSACTAAFTPV
TASAAFAALNPGWNLGNTLDAVPDEGSWNNPAVTPATFSAVKAEGFNSVRIPVTWAYHFV
TSSPSWTVNTTWMDRVETVVDQALATGLYVILNVHHDSWIWADVSAGGANLTMIEEKFSA
LWSQIATRMKCKSSKLLFEAINEPPGTTQENANELNKLNTIFLAAINQAGGYNPQRVVSL
SGLQMNSVYTQQWFTKPTTYTSQPWGLQFHYYSPYMLIFDAWGDTIWGSDADKATLTSDF
QQFAGNFTGIPTLIGEWQATPNFVEPAARWKYTDFFVKTAKSFNFAHVLWDNGLDFYDRP
TNTWIDPISMSILFNGVKGVTNSLADSSTDYLATSWNSSAYLFHKVGDAVVAQSVPYLLN
GNTLTSIKTSTGTTLATTSYSMSSSGVLTFTQAYLATLYSATTAAGIKATLTLTFSAGAP
SQLQIVQWATPTLSQTSFTKQTAADLTIPINYAGLPQVAAIKALNADGSYMVSGDDWTQY
LGPLQQARWTWGSWSSSSAGLTIPVSGLTVISSSSQKVTLTLEFFPRIQGQNSVNITFT
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgctgcaattttcagcgtgctgtccttggcagtggatactacatccgcaacc
tccataccaacaacatctacgacctctaagccaatcacatccacaacttcatcctcgaaa
actagttcggcggcaacctcaacggtccaatcagcctgcactgctgcattcaccccagtt
actgcttctgccgcatttgctgcattgaacccagggtggaatctcgggaatacgttggat
gctgtcccagatgaaggatcctggaataatcctgctgtcactcctgctaccttttcggca
gtgaaagctgaggggttcaatagcgtcagaataccagtaacttgggcataccactttgtg
acttcttcccccagctggaccgtcaataccacttggatggaccgagttgaaacggtcgta
gatcaagcccttgctactggattgtacgtcattctcaatgtccatcatgattcttggatt
tgggcagatgtctctgcaggtggtgccaatcttaccatgatcgaagagaaattctctgcc
ctttggtctcaaatcgcaacgagaatgaaatgcaaatctagtaaattactttttgaagct
atcaatgagccacccggaacaacacaagagaacgcgaacgaacttaacaaactcaatact
atcttccttgcagccatcaaccaggctggaggttacaaccctcaaagagtagtttccctt
tcaggtcttcagatgaattcggtttatactcagcaatggttcaccaagcccacaacttat
acaagtcaaccttggggtcttcaatttcattattactcaccctacatgttgatctttgat
gcttggggagataccatctggggttctgatgccgataaagccactttgacatcagacttc
caacagttcgcaggtaacttcacaggcatcccgacattgattggagaatggcaagctaca
cctaactttgttgagccagccgctagatggaagtatacagacttttttgtgaaaaccgcc
aagagtttcaattttgctcatgtactctgggacaatggacttgatttctacgaccgtcct
acaaatacttggatcgatcctatctccatgtcaatacttttcaacggcgttaaaggagtc
accaactcccttgcagacagttcaacagattatctcgctacatcctggaattcctcggct
tatctcttccataaagttggcgatgctgtcgtcgcacaatctgttccttatctcttgaac
ggaaataccttgacatctatcaaaacttccacgggcacaacattagcaaccacctcgtac
agcatgtcctcatccggtgttttgaccttcactcaagcttatctcgcaaccctctattcc
gctacaacagccgccggtattaaagccaccctaactttgaccttctctgccggtgctcct
tcccaactacaaattgtgcaatgggctactccaaccctctcacaaacgtccttcaccaaa
caaactgctgcagacctcacaatcccaattaactatgcgggactcccacaagtcgcagct
atcaaggctttgaatgcagatggttcgtacatggtttctggtgatgattggacccagtat
ttgggaccattacagcaagctcgatggacctggggctcttggtcaagtagtagtgctgga
ctgaccatccctgtttcgggattgactgttatcagtagctcttctcagaaggttactttg
acacttgaatttttcccgagaattcaaggacagaacagcgtgaacatcactttcacctaa

DBGET integrated database retrieval system