KEGG   Botrytis cinerea: BC1G_07955Help
Entry
BC1G_07955        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
bfu  Botrytis cinerea
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    BC1G_07955
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     BC1G_07955
Protein kinases [BR:bfu01001]
 Serine/threonine protein kinases: Other group
  TTK family
   BC1G_07955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 839 aa AA seqDB search
MATASPTPMGSSQFAAIRRPASRNAYKQPPNRPSSTRPDTEAARHYSLNDSSDDEIPMPM
KLSALTKALLDDEASVVETPIAARTTPEHPQTSHTRVESAGILGSSTRGKQSPLGSRENS
PTYPRRVVRVSGTPGSTSLRRGPSLSSAVQKHNEQQAAPKTEAGALDLSTPAPVPRTVRV
SIGRTSIGSSGRPSGRSESPQQENEYENEGQYEYPSTVTRSHLAVSQGSVSRYNPSTVGR
SRYGEEVGLQSSMRVKRGAVPKVFGTFMRGPARRGRPRISQSDEEQSPMEENANSNEVGS
NQEPQSQESQYGEQESQNKSPTPELELARRAPISSYRDYASSGSPSSKNGLNSALHSRSP
PPPTLSSSRGSDPRSVPSASKQQPVFKIPAPRPGVPATYDQENDAPPTFRRNKQPSTNTN
SAEKQTRPESFDIRANGSPERRPLAVRSQNTPRRPAPPPPKMSVLEAATSTAGAATTSHA
NNRRNRLKVNGKIFTRLDVIGRGGSSKVYRVMAENSKIFALKRVSLEDADESAIRGFKGE
IDLLKKLGSVERVIHLYDYELNDERGVLSVLMEMGELDMNTILNLRMKSEQAKLDINFVR
YYWKEMLECLQAVHAYDIVHSDLKPHNFVLVQGRLKLIDFGIANAIQTEETVNVHRETQI
GTPNYMSPESLMDSNASDGRNRNEPKLMKLGKPSDIWSLGCILYQMTYGRAPFGHIQNQL
QRCQAIINFSYEIEYPAYGVGGVLVPSSLIRTLKNCLNRDQHKRPSAEELLGDNDTFLNP
LEIDLDKHFPMSEELLGRILQNVIQKCEALGRVPSEGELLTSWPKGYFASLRKAERGGT
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcttcaccaaccccaatggggtcgagtcaattcgcagctatccgaagacct
gcctcacggaatgcatacaaacagcctcctaaccgaccgtcttctacccgtccagataca
gaagcagctcgacattattcgctcaacgacagctccgacgacgaaattccaatgccgatg
aaattgagtgccctaaccaaagctttactagacgacgaggcctcagttgttgaaacccca
atcgctgctcgtacgacaccagagcaccctcaaacatcacacacaagagtggagagtgcg
ggtatattggggtcatctaccagggggaagcaatcgccgcttgggagccgtgaaaatagc
cctacctatccacgacgagttgtgcgagtgagtggcacgcctggctctacatcgctacgg
agaggtccttcattatccagtgcggttcagaagcacaatgaacagcaagcagcaccaaaa
acggaagcaggcgcattagatcttagcacgccagcaccagtacctcgaaccgtacgagta
tctatcggtagaacttcaattggctcttccggaagaccttctggtagatcagaatcccca
caacaggaaaacgagtatgagaatgaagggcaatatgaatatccttcaacagttacaagg
tcacatctagctgtgagccagggaagtgtatcgagatacaatccctctaccgtaggccgt
tcgaggtatggcgaagaagtaggattgcaaagttcgatgagagtcaagaggggtgcagtt
cccaaagtttttggaacattcatgagaggcccggctcgcagaggacgaccacggatatct
cagtcagatgaagaacagagcccaatggaggagaatgcaaacagcaatgaagtcggatct
aatcaagaacctcaaagtcaggaatcgcaatatggggaacaagaaagccagaataaaagt
ccaacgccagagttagaattagctaggcgggctcccatctcctcgtacagagactacgcc
tcttcaggcagtcctagctcgaagaacggcttaaattcagccctgcattctaggtcgcca
ccaccccccactttatctagttctcgcggatctgatcctcgctccgttccctctgcgtcg
aagcaacaacccgtgttcaagataccagctccacgtccaggtgttcctgcaacttatgat
caagaaaatgatgcgcctccaacatttaggcggaataaacagccttcaacaaacacgaat
agtgcggaaaagcaaactcggccagaaagcttcgatatacgtgccaatgggtctccggag
agacgtcctctggctgtccggagtcagaatactcctcgaagacctgcaccacccccacca
aagatgtcggtattagaggccgcgaccagtactgcgggtgccgctactacatctcacgcc
aataaccgaagaaataggctgaaggtcaatgggaaaatattcacacgtttggatgtcatt
gggcgtgggggtagttcgaaagtataccgagtgatggcagagaactcgaaaatattcgca
ttgaagcgtgtttccttggaagatgcagatgaatcggctatacgtggtttcaagggcgaa
atcgacttgttaaagaagctaggctcagtagaaagagtaattcacttatatgactacgaa
ttgaatgatgagagaggagtccttagtgtgcttatggagatgggagaattggatatgaac
acaatcttaaatctgcgcatgaaatctgagcaggccaagttggacatcaattttgttcgc
tactactggaaagaaatgcttgagtgtctccaagctgttcacgcttacgatattgttcat
tctgatttgaagcctcacaactttgtgcttgttcaaggccgcctcaagctgatagatttc
ggaatcgccaacgcaatccaaacagaagaaactgtaaacgtccatcgtgaaacacaaatt
ggtactccaaattatatgtcccctgaatccctcatggactcaaacgcttctgatgggagg
aatcgcaacgaaccaaaactcatgaaactcgggaaaccatccgatatatggagtctgggc
tgtatactttatcaaatgacctatggtcgtgctccatttggtcatattcaaaaccaactg
cagcgttgccaagcgatcataaacttcagctatgagatcgaatatccagcatacggtgtg
ggtggtgttttggttccaagctctttaattcgaaccctcaaaaactgcctgaaccgagat
cagcacaaaagaccatcggcagaagaactattaggggacaacgacacatttttgaatccg
ttagaaatcgatttggataaacactttcccatgtcagaagaattgctaggcagaattttg
caaaatgttatacaaaaatgcgaagcactaggaagagtgcctagtgaaggagaactcttg
acttcctggcctaaaggctatttcgcaagtttacggaaggccgagagaggtgggacatga

DBGET integrated database retrieval system