KEGG   Botrytis cinerea: BC1G_07979Help
Entry
BC1G_07979        CDS       T01072                                 

Definition
similar to GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bfu  Botrytis cinerea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1G_07979
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BC1G_07979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 303 aa AA seqDB search
MVQFANLEGSKEEAEKENKEFNGASSKRKLENHGEGGEVSKKKKKKSKANGHGHRRHSVS
SKPARDPRDEATADTPEETPIEVSRSPSPVIDFDGLSRPSKGARERLDESPEQAAIRMTK
LTGAVRTILECIGEDPDREGLLATPERYAKALLYLTKGYQENVRDIVNDAIFNEDHNELV
IVKDIEVFSMCEHHMVPFTGKMHIGYIPDRNVIGISKLPRIADMFSRRLQIQERLTKDVA
HAVMEILKPQGVAVVMESSHLCMVMRGVEKTSATTITSCVLGCIEKREKTRNEFFSLVGL
NRR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattcgccaatttagaggggagcaaggaggaagcagagaaggagaataaagaa
ttcaatggcgcaagctccaaacgcaaattggagaatcatggggaaggcggggaagtgagc
aagaaaaagaagaagaagtcaaaggccaatggccatggacacagaagacacagcgtcagc
tccaaacctgcccgagatccaagagatgaggcaactgcagatactccagaagaaactcca
attgaagtctccagaagtccaagtccagtcatcgattttgatggattaagccgtcctagt
aaaggcgcacgagagcgtcttgatgaatccccggaacaagcagccatccgaatgacaaaa
ttgaccggcgcagttcgcacaattctcgaatgtataggtgaagatccagatcgagaaggt
ctcttggccacgccagaacgttatgcaaaagcattgctgtatctcacaaaaggataccag
gaaaatgttagggacattgttaatgatgcaatctttaatgaagatcacaatgaattggtc
attgtcaaagacattgaggtcttcagtatgtgcgaacatcacatggttccattcaccgga
aagatgcacattggctatattccggatcgaaatgttatcggtatctcgaagttaccccga
attgcagatatgttctcgcgcagattacaaattcaagagagacttacaaaagatgttgcg
catgctgtgatggaaattctcaagccacaaggtgtagcagttgttatggaatcgagccac
ttatgtatggttatgcgaggagttgagaaaacaagtgctacaaccattacaagttgtgtt
ctgggttgcatagaaaagagagagaagactagaaatgagtttttcagtttggtgggtttg
aacagacgatag

DBGET integrated database retrieval system