KEGG   Botryotinia fuckeliana: BC1G_08125Help
Entry
BC1G_08125        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bfu  Botryotinia fuckeliana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bfu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 317 aa AA seqDB search
MGRIPTFLLKTKSVPNDGYEERFEEVSFNAVRYGGGVEGSERGFEPTFVPVLEHRFVDEG
VDEVKRLLKERGIGREEGKEYGGLIFTSQRAVELFAKLVEEGRSEDDSDEWPYLQNIPIY
TVGPATSRALRSIPQTPALNIFGAESGNGEALAHYMLEHYGNWYKNRCVKPSLLFMVGEQ
RRDIIPRTLMDPELSDGKRIQVDELVVYGTGVMESFEEDFKALLKETEHRDTRWVVVFSP
TGCDAMLRSLGMLDCQTGRIKRANEQEDGKRKTFIATIGPTTRDYLKSTFGYEPDVCAEK
PSPEGVIEGIRKFLDNR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaattccgacgtttttgttgaagacgaagagtgtgccgaatgatgggtatgag
gagaggtttgaggaggtgagctttaatgcggtgaggtatggaggaggggtggaggggagt
gagagggggtttgaaccgacttttgtgccggtgttggagcataggtttgtggatgagggg
gtggatgaggtgaagaggttacttaaggagaggggcattgggagagaagaggggaaggaa
tacggaggcttgatttttacaagtcagagggctgtggagttatttgcgaagttggtggag
gaggggagaagtgaagatgacagcgatgaatggccatatttacaaaacataccaatctat
accgtcggcccagctacatcgcgagcattgcgatcgataccccaaacccccgcgttgaat
atctttggtgccgaatcaggaaatggagaagcactggcgcattacatgttagaacactat
gggaattggtacaaaaatcgctgcgtaaagccatctctactgttcatggttggagaacag
cgaagagatattattcctagaacattgatggatcccgaactatcagatgggaaacggatc
caagtcgatgaactggttgtttatggtacgggagtcatggaatcgttcgaagaagatttc
aaagctctattgaaggagacggaacatagggatacgagatgggtggttgttttttcaccg
acaggatgcgatgctatgttacgatcactaggcatgttagattgccaaacggggagaatc
aaacgagcgaatgaacaggaggatggaaagaggaagacttttattgcgacgattggtcct
accacgagggattatctcaagagtacgtttggttacgaaccagatgtttgtgctgagaag
ccaagccctgaaggtgtaattgaggggattcggaagttcttggacaataggtag

DBGET integrated database retrieval system