KEGG   Botrytis cinerea: BC1G_08125Help
Entry
BC1G_08125        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bfu  Botrytis cinerea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1G_08125
Enzymes [BR:bfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BC1G_08125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 317 aa AA seqDB search
MGRIPTFLLKTKSVPNDGYEERFEEVSFNAVRYGGGVEGSERGFEPTFVPVLEHRFVDEG
VDEVKRLLKERGIGREEGKEYGGLIFTSQRAVELFAKLVEEGRSEDDSDEWPYLQNIPIY
TVGPATSRALRSIPQTPALNIFGAESGNGEALAHYMLEHYGNWYKNRCVKPSLLFMVGEQ
RRDIIPRTLMDPELSDGKRIQVDELVVYGTGVMESFEEDFKALLKETEHRDTRWVVVFSP
TGCDAMLRSLGMLDCQTGRIKRANEQEDGKRKTFIATIGPTTRDYLKSTFGYEPDVCAEK
PSPEGVIEGIRKFLDNR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaattccgacgtttttgttgaagacgaagagtgtgccgaatgatgggtatgag
gagaggtttgaggaggtgagctttaatgcggtgaggtatggaggaggggtggaggggagt
gagagggggtttgaaccgacttttgtgccggtgttggagcataggtttgtggatgagggg
gtggatgaggtgaagaggttacttaaggagaggggcattgggagagaagaggggaaggaa
tacggaggcttgatttttacaagtcagagggctgtggagttatttgcgaagttggtggag
gaggggagaagtgaagatgacagcgatgaatggccatatttacaaaacataccaatctat
accgtcggcccagctacatcgcgagcattgcgatcgataccccaaacccccgcgttgaat
atctttggtgccgaatcaggaaatggagaagcactggcgcattacatgttagaacactat
gggaattggtacaaaaatcgctgcgtaaagccatctctactgttcatggttggagaacag
cgaagagatattattcctagaacattgatggatcccgaactatcagatgggaaacggatc
caagtcgatgaactggttgtttatggtacgggagtcatggaatcgttcgaagaagatttc
aaagctctattgaaggagacggaacatagggatacgagatgggtggttgttttttcaccg
acaggatgcgatgctatgttacgatcactaggcatgttagattgccaaacggggagaatc
aaacgagcgaatgaacaggaggatggaaagaggaagacttttattgcgacgattggtcct
accacgagggattatctcaagagtacgtttggttacgaaccagatgtttgtgctgagaag
ccaagccctgaaggtgtaattgaggggattcggaagttcttggacaataggtag

DBGET integrated database retrieval system