KEGG   Botryotinia fuckeliana: BC1G_08237Help
Entry
BC1G_08237        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bfu  Botryotinia fuckeliana
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bfu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bfu03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 410 aa AA seqDB search
MSVSTLASFEQKDQALSLLSRLHIVDITALSREDPQTVALTKNFGASLRLALTGGGNHQS
FGVPSSDHIAPHVDIDFLDTHARMQWEGILHYMVNTVTSGSGKDGNGPANSVKALLDAGK
LVTRGRGIGITQAGFSFLLQEANAQVWTLLLLWIENAESMGMDSVDVLSFLFMLGSLELG
RAYSTKTLTEAQKGMLANLIDLGLIYLPPSAPTQFFPTRLATTLTSDASALRTVAAGFDA
ASKSAASQKGFIIIETNYRLYAYTNSPLQIAVLSLFTKLNTRYPNMVSGRVSRDSIRTAI
AHGITSDQIITYLSTHAHPQLVKASSASHGGPVLPPTVVDQIRLWQLENERMKAVPGFLM
KDFETQKEYEGCAKYAEEVGVLVWKSDAKRMFFVTRVEQLRDYFKAKKIR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctcaactcttgcttcattcgagcaaaaagatcaagccctttccctactatcg
cgactgcacattgtcgatattactgcgctgagccgagaagatcctcaaactgtagctttg
actaagaattttggagcctctctgcggctggcacttacaggtggaggaaaccatcaatct
ttcggagttccttcgtcggatcatattgcgccacatgttgatattgattttttggataca
catgctcgaatgcaatgggaagggattctacattatatggtcaacactgttacatccggg
tcaggaaaagatggaaatgggcctgcaaattcagtaaaggcactacttgatgcaggaaaa
ctggttacaagaggtcgaggtatcggtattactcaagctggattctcatttctattgcaa
gaagccaatgcgcaagtctggacgttgctccttctgtggattgaaaatgccgaaagcatg
gggatggattccgtcgatgtcctttcttttcttttcatgctaggctccctcgaactcgga
cgtgcatacagtaccaagactctcacagaggctcaaaaagggatgctcgccaatctcatc
gacttgggtctaatttaccttcccccttcagcccctactcaattctttccaacacgtcta
gccacaactctcacctcagatgccagcgcactccgcactgtggctgcaggatttgatgcc
gcctcgaaatccgccgccagccaaaagggtttcataataatcgagaccaactaccgacta
tatgcttacacaaactcaccccttcaaatcgctgttctttcactcttcaccaaactcaac
actcgctatcccaacatggttagtggccgcgtttctcgcgattccatccgtaccgccata
gctcatggcattacatccgaccaaataattacctacctatccactcatgcgcatcctcaa
ctcgtcaaagcttcttccgcatcccatggaggacctgtactaccacctacagtcgttgat
caaatccgtctttggcaattagaaaacgagagaatgaaagccgtaccgggatttttgatg
aaggatttcgagacccagaaggaatacgaaggatgtgcaaaatatgctgaagaggtagga
gtgttggtctggaagagcgatgcgaagaggatgttctttgtcacgagggtggagcagtta
agagactacttcaaagcgaagaaaataagatag

DBGET integrated database retrieval system