KEGG   Botrytis cinerea: BC1G_08301Help
Entry
BC1G_08301        CDS       T01072                                 

Definition
ascorbate peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BC1G_08301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 372 aa AA seqDB search
MASATRTFARAGAAFKSTPFRSATRTALSAPRQAFRQQSRRGYASEGPAKSSFPLSIGVA
ALAIAGGAGYYFVSQGNGSLLSGSAKETSGLFTPKFDDYQKVYNEIAERLEEKDDYDDGS
YGPVLVRLAWHCSGTFDKETGTGGSNGATMRFAPEGDHGANAGLVAARDFLAPIKAKHPW
ISYSDLWILAGICAIQEMQGPVIPFRPGRQDKDAAACTPDGRLPDASQGNKHLRDIFGRM
GFNDQEIVALSGAHALGRCHTDRSGFEGPWTFSPTVVTNDYYKLLLNEKWSWKKWNGPKQ
YEDKTSKSLMMLPTDMALVSDKSFRSYVEKYANDESLFMKDFANVITRLFELGVPFAETT
EQAPMKFKPTTA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgctactcgaacctttgctcgcgcaggcgctgcattcaaatcaacacctttc
agatccgccactcgcactgcattgagtgctcctcgtcaagcattccgtcaacaatcccgt
cgtggatatgcatctgaaggacctgccaaatcttccttccctctctctatcggtgttgct
gctttggccattgctggaggtgctggatattactttgtttctcaaggtaatggatcactc
ttgagtggttctgccaaggaaacctctggtctcttcacacctaaattcgacgattaccaa
aaggtttacaacgaaattgcagagagattggaagagaaggatgattatgatgatggttct
tacggacccgtcttggtcagattggcgtggcattgcagcggaacttttgacaaggaaact
ggtactggtggtagcaacggtgctactatgagattcgccccagagggtgaccatggtgcc
aatgctggcttggttgctgctagagatttcttggctcctattaaggctaagcacccatgg
atctcctactctgatctctggatcttggccggtatctgtgctattcaagaaatgcaaggc
ccagtcattcctttccgaccaggtagacaagataaggacgctgctgcttgcacacctgat
ggacgtcttccagatgcatcccaaggtaacaagcacttgagagatatcttcggtcgtatg
ggattcaatgatcaagaaatcgttgctttgagtggtgctcacgctcttggacgttgccac
actgatcgtagtggtttcgagggaccttggactttctctccaacagttgttaccaacgac
tactacaagctcttgttgaatgagaagtggagctggaagaagtggaatggtcctaagcag
tacgaagacaagacctccaagtctctcatgatgcttcccaccgacatggccctcgtctct
gataaatcttttcgctcatacgttgagaaatacgcaaatgatgaatctctcttcatgaag
gacttcgcaaatgtcatcaccaggctctttgagctcggtgttccttttgcagagactact
gaacaagctcccatgaaattcaagcctactactgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system