KEGG   Botrytis cinerea: BC1G_08505Help
Entry
BC1G_08505        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K15218  
RNA polymerase I-specific transcription initiation factor RRN6
Organism
bfu  Botrytis cinerea
Brite
Transcription machinery [BR:bfu03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factor
    Transcription initiation factors
     BC1G_08505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 985 aa AA seqDB search
MTDHRATDLVHGHFGEFSYDINEEQWSFSQDVNRVHRFQQLLSSTQCIPPSIRDIPGNGK
VGSKIARAQQKWLAKKRPETFPGGSLATHLSKDASDATLNRSKASTLMAIGGAADINHTS
GSKIAFIVAIPCGEAGHILKLVKPRPEKLGWESHNGVRLSYMSAANTDQGHWFGAGGTIL
QIASADDGNELSAWFAVRQAAMTTIFRPVFRKFPKPFTAPAGHIAAYPPSCLDPNPVATL
TCQQSGSEEHVDVSFNPWYARQFAVVDRAGKWSSWDIEGRQKKRSAFEIMPGKKGYIYDD
FGEDPAIPTYKLPGNVGDWHRVLWAGSVSTMIVANRKHLAVFDTKSKPTRLPSYLFNTSL
LKDWILDIKRSTVDLSHLFVLTTTRIFWLKVIPTGEDGLNRDSGIKVILSHRHYRTPTDE
TMKLTMSKDENGTDLTVFISSSENSCLNSYTFFMDGKNARTFEGGFRLSPGISEEKTLKA
ESISIRSVSYLIPRDSAEGMGLDFMETGVKFHQTWMLTPSLELVSSLWASEILNSQKKWS
SRPILLAPMHKIADNTIRMTASRLADDFIVPDEEDEDALVDQMSSLTTQNGQFSSKINKA
STDLLLRINMQPVFERIFNKPMSSDSNTDMETAFRDISIQMQNGKQMDSMSLKTCLELSN
NASPSGDLDEAAKIVTEFLDFMNTFDEGEEESSSKFHISKLISCPGMTFSEDPSSDDKCP
DLLQIYDQLINVWVTNLPRKTPGPVRLEKARSIRRIAMEIWLSSVGISLRNEQFEPRPPP
VFEDETSMHMLKDIDELSRASSPPYFSSQAQSRAMENPQLSLPTPTPSVISAPAVVQDPT
ISRLRQYAVSIEPKIEFGAARASLLSQWPSVPGADPNKYSWEEVQRAALAEESGDDDYRS
RRENARRKRRAERFLSRDRANAAASSSQAMAQPFGSQPVGYNTYSSQPVNELPMTQPSKG
AFGSRIAAPATPGKKKSKKRRAAGF
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccacagggcgaccgacctggtacatggtcattttggtgaattctcttacgat
attaacgaagagcaatggtcgttttcgcaagatgttaacagagttcatcgatttcagcaa
ctcctttcatccacacaatgcattcctccctcgattcgagatatacctggaaatggaaaa
gtaggctcgaagattgctcgagctcaacagaaatggctcgcaaagaagcgacccgaaaca
tttcccggaggaagtcttgctacacacttgtccaaagatgcctctgatgcgacactgaac
cgatccaaggcgagcacgttgatggccattggaggggctgcggatatcaatcatacctct
ggttccaaaatcgcattcatagtagcgatcccgtgtggtgaggccggccatattctgaag
cttgtcaaacctcgcccagagaaacttggatgggagtcgcataatggagttcgactatct
tacatgagtgctgccaatacagatcaaggacattggtttggtgctgggggaacaatttta
cagattgcctctgccgatgatggcaatgaacttagtgcttggttcgctgttagacaagca
gccatgacgactattttcagacctgtctttcggaaatttcccaagcctttcacagcccca
gctggacacattgctgcatatcctccatcatgtctagaccctaatcctgtcgcgacttta
acatgccaacagtctggatcagaggaacacgtggacgttagttttaacccatggtacgct
cgacaattcgcagttgtagaccgcgctggcaaatggagtagttgggatattgaagggcga
caaaagaaacgctcggcttttgaaatcatgccagggaagaaggggtatatttacgacgat
tttggcgaagatcctgctattccgacatataaattacctggaaacgttggcgactggcac
cgagtcctctgggcaggtagcgtgagcactatgatagttgcaaatagaaaacatcttgca
gttttcgatacaaaatccaagccaacacggctaccctcttatttatttaatacctcactg
ctaaaagattggatactggacatcaagcgcagtacggttgatctttcacatttgtttgtt
ttgactacgactcggattttctggctaaaagtcataccgactggcgaagatggcctgaac
agggattctgggatcaaggttatcctgtcgcatcgccactacagaactccaaccgacgag
acaatgaaattgacaatgtccaaggacgaaaatggaacggacttgacagtattcatttca
tctagtgaaaattcatgtctgaattcctacactttttttatggatgggaaaaacgcaagg
actttcgagggagggtttaggctgtcccctgggataagcgaggaaaagacacttaaggcc
gagagtatctctatacgttccgtctcttatctaataccaagagactcggctgagggaatg
ggactagacttcatggaaacaggagtaaaatttcaccagacatggatgctaacgccaagt
cttgagctggtatcttccttatgggcgtctgagattctcaattctcaaaagaaatggagt
tcaagacccatcctgcttgcgccgatgcacaaaattgcggataatactatccgcatgaca
gctagtcgtcttgcagatgatttcattgttcctgacgaggaagacgaagatgctttagtg
gatcagatgagctccctaacaacgcaaaatggccagttttcatcgaaaattaataaagct
tccacagatctgcttctaaggattaacatgcaaccagtgttcgaacgaatatttaacaag
ccaatgtccagtgattcgaacactgacatggaaacggcatttcgagatatatcaattcag
atgcaaaatggcaaacaaatggatagcatgtcattaaaaacttgtctcgaattatcgaac
aatgcatctccttcaggtgacctcgacgaggcagccaaaattgtgactgagtttctggat
ttcatgaacacctttgatgaaggcgaagaggaatcatcttctaaatttcatatttcgaaa
ttgatatcttgtcccggaatgaccttttctgaagatccatcatccgacgataaatgccct
gatttattgcaaatatatgatcaactgatcaatgtctgggtaacaaacctccctcgcaag
actcctgggccagttcgtttggaaaaagcgagatcgatacgcagaattgctatggaaata
tggctgagctcagttggtatttcgctacgaaatgaacaatttgagccgagacctccacca
gtctttgaggatgaaacctcaatgcacatgttgaaggacattgacgaactctcaagggcc
agttcacctccgtatttcagctcccaggctcagtcccgagcaatggagaatccccagctc
agcttgcccacgcccactccatcagtcatatctgcccctgcagttgtgcaggatcctacg
atttcgcgacttcgccagtatgctgttagcatcgagccaaagatagaatttggtgcggca
agagcttcactattatctcaatggccatctgttccaggcgcagacccaaataaatactcc
tgggaggaggttcagagagctgcacttgcggaagagagtggggacgatgattaccgtagt
cgacgagaaaacgctcggcgtaaacgaagagcagaaaggtttttgagtcgagatcgtgcg
aacgcagctgcatcttcatctcaagctatggctcaaccatttggcagtcaaccggttggt
tacaacacttacagctcacaacctgttaatgaattaccaatgacccaaccgagcaaggga
gctttcggtagccgaatcgctgcacccgctactcctggaaagaaaaagtctaagaagcgt
agggcagcaggtttttaa

DBGET integrated database retrieval system