KEGG   Botrytis cinerea: BC1G_08529Help
Entry
BC1G_08529        CDS       T01072                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bfu  Botrytis cinerea
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BC1G_08529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 108 aa AA seqDB search
MGFKAGDAKKGANLFKTRCAQCHTLGEGEGNKIGPNLHGLFGRQTGSVEGYSYTDANKQK
AITWDENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLIQHLKEATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaaagcaggagacgcaaagaagggtgccaacctcttcaagaccagatgtgct
caatgccacactctcggtgagggtgagggaaacaagatcggtcctaacctccacggtctt
ttcggacgtcaaactggttccgttgagggctactcatacaccgatgccaacaagcaaaag
gctatcacctgggacgagaacacacttttcgaatacctcgagaacccaaagaaatatatc
ccaggaaccaagatggctttcggtggattgaagaaggacaaggacaggaacgacttgatc
caacacttgaaggaggccaccgcataa

DBGET integrated database retrieval system