KEGG   Botrytis cinerea: BC1G_08755Help
Entry
BC1G_08755        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bfu  Botrytis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1G_08755
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BC1G_08755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 542 aa AA seqDB search
MLFSRTATILSLLCVQATAISPRGSAASYSSLDSFIASERKIALQGVLNNIGPDGSKASG
AGNYVIASPSKTNPDYFYTWTRDSALTLKMLVDEFIFGNRALQPQIEKYVKAQAILQTVT
NPSGTFLPNGLGLGEPKYEVDGTRFNGAWGRPQRDGPALRAIALMAYSDWLINHNQLQRA
KLVIWPIISNDLSYIGEYWNQTGYDLWEEVLGSSFFTVQNQHRAFVEAGNLANRLGVESP
GYLNALEALCFLNQSFWNGEYIVSNINVDNGRTGYLLTTAAAEFLYDAVAQWRNQKKLTV
DSTSINFFRDLYPSIKLKSYTNRDNEFNKILNVVTKYADSFVAIAQKYTPSSGSLAEQFD
RNTGAPISANDLTWSYAAFVTMAQRRSGQYPASWGSAAASVPPPNCASSSSQGVYVPAIA
AGAPNVTATCQYPVRFYVNATTYYGENLYIIGNTTDLGAWNLNSALPMNAGMYTTENPVW
YVDAQLTAGEPVSYVYVREQDCGQAPIYETNNRTSVVPECGTGGSTIRRDVWVGSGGSSG
GC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgctgttttctcgaactgccacgattttgtctctgctatgtgtacaagcaactgcaatt
tcaccgagaggttcggccgcaagttatagtagtcttgattccttcattgcttccgagaga
aagattgctctgcagggtgttctcaacaatattggaccagacggatcgaaagcatcagga
gcaggcaattatgtcattgcaagtccttccaagaccaatcctgattacttctatacctgg
actcgagattctgcgttaacgttaaaaatgcttgttgatgaatttatttttggcaatcgt
gcactccagcctcagattgagaaatacgtgaaagctcaagccatccttcaaactgttacg
aatccttctggcactttccttcctaacggtttaggacttggtgaacccaaatacgaggtt
gacggtactcgatttaatggtgcatggggtagacctcagcgcgatggtccagctcttcgt
gctatcgcattaatggcctacagcgattggttaattaatcataatcagcttcaaagagcc
aagctagttatatggcctataatctcaaatgacttatcatacattggcgaatattggaac
caaactggatatgatttatgggaagaagttctaggatctagcttttttaccgtacaaaat
caacaccgtgcttttgttgaagccggaaatctggccaatagactcggtgttgaatctcca
ggatatcttaatgcattagaagctctatgcttccttaatcaaagtttttggaacggagaa
tatatcgtttcgaacatcaatgtcgataacggaagaactgggtacttacttaccactgcg
gccgcagaatttctttatgatgctgttgcacaatggagaaatcagaaaaaacttaccgtt
gattcaacatccattaatttcttccgcgatctttacccatctatcaaacttaagagttac
acaaacagggacaacgaatttaacaagattcttaatgtcgtaacaaaatacgccgactct
tttgtcgcaattgctcaaaaatatacacccagtagtggatctttagccgaacaattcgat
cgcaatacaggagcccccatttctgccaatgaccttacatggagttatgcggcatttgtc
accatggctcaaagacgttcaggtcaatatcctgctagttggggaagtgcggcagcatcg
gttccacccccaaattgcgcatcttcatcttctcaaggagtgtatgttccagccattgca
gcaggggccccaaatgtaacggcaacatgtcaatatccagtgcgattttatgttaatgcc
acaacatattatggtgaaaacctctacattattggaaatacaacggatttgggagcatgg
aacttgaacagtgcattacctatgaatgcagggatgtacacgacggaaaaccctgtttgg
tatgtggatgcgcagttaacggctggggagccagtcagttatgtttatgtgagagaacaa
gattgcggtcaagctccaatttacgagacgaataatcgaacaagtgtggttccggaatgt
ggtacaggtgggtcgacgatcaggcgtgatgtatgggtcggtagtggaggaagtagtgga
gggtgttaa

DBGET integrated database retrieval system