KEGG   Botrytis cinerea: BC1G_08882Help
Entry
BC1G_08882        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfu  Botrytis cinerea
Pathway
bfu00010  Glycolysis / Gluconeogenesis
bfu00051  Fructose and mannose metabolism
bfu00562  Inositol phosphate metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
bfu01230  Biosynthesis of amino acids
Module
bfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bfu_M00002  Glycolysis, core module involving three-carbon compounds
bfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_08882
   00051 Fructose and mannose metabolism
    BC1G_08882
   00562 Inositol phosphate metabolism
    BC1G_08882
Enzymes [BR:bfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BC1G_08882
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BC1G_08882
  Exosomal proteins of bladder cancer cells
   BC1G_08882
  Exosomal proteins of melanoma cells
   BC1G_08882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5433531
NCBI-ProteinID: XP_001552990
AA seq 247 aa AA seqDB search
MPRQFFVGGNFKMNGSVDSIKKIVGNLNDAKLDPNTEVVIAPPALYLLLTREHLRPGLEV
AAQNVFDKPNGAFTGEISVEQLKDSNITWTLLGHSERRVILQEDDSFVACKTKAALDGGV
GVIFCCGETLEQRESNKTIEVVTAQLKAVKDKVQDWSKIVIAYEPIWAIGTGKVASTEQA
QEVHAAIRSWLKKEVSEKAAEETRIIYGGSVSEKNCKDLSKQEDIDGFLVGGASLKPAFV
DIINSHL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcaattcttcgtcggaggtaacttcaagatgaatggatctgttgattccatc
aagaagattgttggaaacttgaacgatgccaagttggacccaaataccgaggttgtcatt
gctccacctgctctttaccttctccttacccgcgagcacttgagacctggacttgaggtt
gcagcacaaaacgttttcgacaagccaaatggagctttcactggtgaaatctccgttgag
caactcaaggacagcaacattacctggacacttctcggacactctgagcgtcgtgtcatt
ctccaagaagatgattcattcgtagcatgcaagaccaaggctgctcttgatggaggagtt
ggtgttattttctgctgcggagagacccttgagcaaagagagtctaacaagacgatcgaa
gttgttaccgcacaattgaaggctgttaaggataaggttcaagactggtcgaagatcgtc
attgcatatgagccaatctgggctattggtactggaaaggttgcttccaccgaacaagca
caagaggtacacgccgccatccgttcctggttgaagaaggaggttagcgagaaggctgca
gaggagaccagaatcatctacggtggaagtgttagcgagaagaactgcaaggatttgagc
aagcaagaggacattgatggtttcttggttggaggtgcttcattgaagccagctttcgtt
gatattatcaacagccacttgtaa

DBGET integrated database retrieval system