KEGG   Botrytis cinerea: BC1G_08882Help
Entry
BC1G_08882        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfu  Botrytis cinerea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_08882
   01230 Biosynthesis of amino acids
    BC1G_08882
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_08882
   00051 Fructose and mannose metabolism
    BC1G_08882
   00562 Inositol phosphate metabolism
    BC1G_08882
Enzymes [BR:bfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BC1G_08882
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BC1G_08882
  Exosomal proteins of bladder cancer cells
   BC1G_08882
  Exosomal proteins of melanoma cells
   BC1G_08882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 247 aa AA seqDB search
MPRQFFVGGNFKMNGSVDSIKKIVGNLNDAKLDPNTEVVIAPPALYLLLTREHLRPGLEV
AAQNVFDKPNGAFTGEISVEQLKDSNITWTLLGHSERRVILQEDDSFVACKTKAALDGGV
GVIFCCGETLEQRESNKTIEVVTAQLKAVKDKVQDWSKIVIAYEPIWAIGTGKVASTEQA
QEVHAAIRSWLKKEVSEKAAEETRIIYGGSVSEKNCKDLSKQEDIDGFLVGGASLKPAFV
DIINSHL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcaattcttcgtcggaggtaacttcaagatgaatggatctgttgattccatc
aagaagattgttggaaacttgaacgatgccaagttggacccaaataccgaggttgtcatt
gctccacctgctctttaccttctccttacccgcgagcacttgagacctggacttgaggtt
gcagcacaaaacgttttcgacaagccaaatggagctttcactggtgaaatctccgttgag
caactcaaggacagcaacattacctggacacttctcggacactctgagcgtcgtgtcatt
ctccaagaagatgattcattcgtagcatgcaagaccaaggctgctcttgatggaggagtt
ggtgttattttctgctgcggagagacccttgagcaaagagagtctaacaagacgatcgaa
gttgttaccgcacaattgaaggctgttaaggataaggttcaagactggtcgaagatcgtc
attgcatatgagccaatctgggctattggtactggaaaggttgcttccaccgaacaagca
caagaggtacacgccgccatccgttcctggttgaagaaggaggttagcgagaaggctgca
gaggagaccagaatcatctacggtggaagtgttagcgagaagaactgcaaggatttgagc
aagcaagaggacattgatggtttcttggttggaggtgcttcattgaagccagctttcgtt
gatattatcaacagccacttgtaa

DBGET integrated database retrieval system