KEGG   Botrytis cinerea: BC1G_09029Help
Entry
BC1G_09029        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bfu  Botrytis cinerea
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC1G_09029
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BC1G_09029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 406 aa AA seqDB search
MFHSLIPFLTFLPAAITTIAPSGPYQRPLKLTNNQHQNFVASSIFAPYENGVSELEHPVG
LKPTFEWRTFEEDDLISNAGGTFAHLPAVDCFDPENDGTFDVAIVGHPFDLGVTYRPGAR
FGPNAARQGARRMSPGIENNVNPFRDWATVVDCGDISNTPFDKHLALKQLENGMKSINSR
SPKNDTDGKAIRAISIGGDHTITLPILRALHSTWGRVAVLHFDSHLDTWDPVQLGGGLSK
YTDVNHGTMLHIAHEEGLLSNHSNMHLGTRCPLMDQHFDLNNDLRCGFTYIRARELDKLG
IKEVVRKIVERVGDEYVYLSVDIDVLDPAYAPATGTIEPGGWTTRELLQIIGGLSEAGLK
IVGSDVVEFTPIYDNSAETTGIAVGEIIYEILQWMVNVPVVPRKST
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttcattctctcatcccatttttaacattcctacccgctgcaatcacgaccatcgct
ccttcagggccatatcagcgaccactaaaacttacgaataaccaacatcaaaatttcgtc
gcctcatctatttttgccccctatgagaatggggtctccgagctagaacatccagttgga
ttaaagccaacatttgaatggcgaacttttgaggaggatgatttaatatccaacgcaggc
ggaacatttgcacatctacctgctgtggactgtttcgatcccgagaatgacggaacattc
gatgtggcaatcgtaggccatccatttgatctaggagtcacatatagacccggtgcgaga
tttggtccgaatgctgcacggcaaggggcgagaaggatgtctccgggtattgaaaataac
gtgaatcctttccgcgactgggccactgtggtcgattgtggagacatttcgaatacgccg
tttgataagcatttggctttgaaacaactcgagaatggcatgaaatcaatcaactcgcga
agtccaaagaatgataccgatggcaaggctatacgggccattagcataggtggcgatcat
accattactttacctattctccgagctctccactcaacatggggacgtgttgccgttttg
cactttgactcccatcttgatacatgggatccagtacagcttggtgggggactatcgaag
tacaccgatgtcaaccatggaaccatgttgcacattgctcatgaggaagggcttttgtca
aatcatagcaacatgcatctaggaacacggtgtccacttatggatcaacattttgatctg
aacaacgatctaagatgcgggtttacatatattcgagcaagagagctcgacaagcttggc
atcaaggaagtggttcgaaagatcgttgaacgcgtgggcgatgagtatgtgtatttgagt
gtagatattgatgtattagatccagcttatgcacctgcaactggaacaatcgagcctggt
ggatggacaacacgagagttgttgcaaatcattggtgggttatcagaagcagggctgaag
attgtaggatcagatgtcgtggaattcactccaatttatgacaattcagctgaaactact
ggcattgctgttggagagatcatttatgaaatccttcaatggatggtaaatgtcccggtg
gtacctagaaagtcgacatag

DBGET integrated database retrieval system