KEGG   Botryotinia fuckeliana: BC1G_09086Help
Entry
BC1G_09086        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 880 aa AA seqDB search
MNGRHLPAGQGMQQDLGRRRPYGHQAQPYPPAAPLYNAYMHPYNANYYHPQPLPPQYYNN
GLTQQYNPYQHYGRSPPPMMTHYTHPPPPPLQPQAPPFVRPQPSPAIAASHPPVIASSYQ
PAPAPPLPQTPSSFSTQSSNTLSAGPLTPPTPQIQPVAQSPPPAPKHYIPFQAPLPWISP
NTTAPWPTRRRRKRKQSPELSMNPVELPSLDKDVDTESKKGVEMSEPSSEPKPSPEEASE
PTPETPTTTQGPSEDTESTVPTTPSSTKPSSLLAGGEVTPVATKSQRATVPAVPAIPAIR
AIPKSQPKSMPSTNSQNTNGEVVAEAELTKSEVTNENEANDPTTEEVEATPPPPKAWATP
RAWTGLFGSSGAPTAPTTVNGGQNGSSEIGKSNSESLAEALRSFKAEAKDSKISFLEPRG
LVNTGNMCYMNSVLQVLVFCTPFYDFLDQVSKKAAHSFKSQTPLIDAMIMFMREFSVIDS
AKSVEQLKMRLKDGELEQYGDSFTPDFVYDVMRRLPRFVTMQRGHQQDAEEFLGFLLEGL
HDECVHVMKSSESSKNSADTTPMNVPSSPISDTASRRGSVDDVWQQVGPKQKAAITRSSG
TILTGSPVTKIFGGSLRSELRVPGLKDSITLEPYQPLQLDIGSPDIHNIVDALRGLTHSE
VLHGDFKSPKGPNVTATKQVFIETVPPVLILHLKRFQYDNTGGTQKIWKKVEYPLELELP
KEVFPRTRRSVFAHDGYPKYRLIGVVYHHGKNASGGHYTVDVRRQDGKEWIRLDDTVIKR
VRSEDVAEGGSEEDPKVLAAALEAHKKDSSSSGNIFASIGEENGEAEEDGWKQASGSGKK
WSSVVNGASTPKSKPATGYAAGKSSLMDNKVAYLLFYQKV
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtcgtcatctgccggcagggcaaggtatgcaacaagacctgggaagaaggaga
ccttatggtcatcaagctcaaccatatccaccggcggcacctctgtacaatgcgtacatg
cacccgtacaacgcgaattattaccatcctcaaccattgcctcctcagtattacaataat
ggcttgactcaacaatataacccatatcaacactatggtcgttcgcctccgccaatgatg
acgcattatactcacccacctccacctccacttcaaccccaagcaccacctttcgttcga
cctcagccatctcctgctattgctgcttctcacccaccagtaattgcgtcctcttaccag
ccagctcctgcgcctccactgcctcaaactccctcgagcttctcaacccaatcgtccaac
accctttctgcaggacctctcacgcctccaactccacaaatacagcctgttgctcagtct
ccgcctccagctcccaaacactatataccttttcaggcacctttgccttggatatccccc
aacactactgcaccctggccgaccagacggcgccggaaaaggaagcagagtccagagttg
tctatgaatcccgtggagcttccaagtctagacaaggatgttgatactgagtcgaagaag
ggcgtagagatgtcggagccatcgtcagagccaaagccgagccctgaagaagcttcagag
cctacacctgaaacacctactactactcaaggtccatcagaagacactgaatctacagtc
ccaactactccatcttctacaaaaccttcgtctctacttgcaggtggagaagtaactccc
gtagctacaaaatcccagcgagctactgtgcctgcagtccccgccatccctgccatacgt
gccattccaaagtctcaacccaaaagcatgccatcgacaaattctcaaaataccaatggt
gaagttgtagctgaggcagaattgaccaagtctgaagtgactaatgagaatgaagccaat
gaccctactactgaggaagttgaggcaacacctccccctcccaaagcgtgggctacacca
agagcttggactggtctctttggttcatctggcgctcctaccgctcctaccactgtcaat
ggtggacagaatggatcctctgagattggcaaaagtaattcggaatcactagctgaagca
ttgcgctcattcaaggccgaagccaaggactccaaaatatcatttcttgagcctcgaggt
ctagtgaacactggtaacatgtgctatatgaattctgttttacaagttctcgttttctgt
acccctttctatgactttcttgatcaagtcagcaagaaagcagcgcatagcttcaaaagt
caaacacctttaattgatgcaatgattatgtttatgcgggagttttcagttattgattct
gcaaaatcagttgagcaactcaaaatgagacttaaagatggggaacttgagcaatatgga
gattctttcacgccggatttcgtctacgatgttatgcgacgtttaccgagatttgtcaca
atgcagaggggacaccaacaagacgcggaagaattccttggctttttgcttgaagggctt
catgatgaatgtgtacatgtcatgaagtcaagtgaatcgagtaaaaattcggctgatacc
acacccatgaacgtaccttcgtctcctatcagcgatactgcgagtcgacgtgggtctgtt
gatgatgtatggcaacaggttggacctaaacaaaaagctgccattacaagatcttctgga
actatacttactggctctccagtcactaaaatctttggtggtagcttgagatccgaattg
cgtgtaccaggcttgaaagattccattactcttgagccatatcagccactccaactggat
atcggttccccggatattcataacatcgttgatgccttgagaggcctgacacattcagag
gtccttcatggcgatttcaagtctccaaagggtcccaacgtaaccgcgacaaagcaagta
ttcatcgagacggtaccccctgtactcatcttgcacttgaagcgtttccaatacgacaac
accggcggcacacaaaagatttggaagaaggttgagtatcctttggaactcgaattacca
aaggaagtctttccaagaactaggcgtagtgtttttgcccatgatggctatccaaagtat
cgcctgattggcgttgtctatcaccacggtaagaatgccagcggtggacactatactgta
gacgttaggagacaagatgggaaggagtggatcagacttgacgatactgttattaagcgt
gtaaggagtgaagatgtagctgaaggaggaagtgaagaagatccaaaagttttggctgct
gctttagaggcccacaagaaggatagttcatcgtcgggaaacatctttgcctcaatcgga
gaagaaaatggagaagctgaggaggacggatggaaacaagccagtggatctggaaagaaa
tggtcaagtgtagtaaatggcgcttccacaccaaagtccaaacctgccactggatatgcg
gctggtaaatcctcacttatggataacaaggtcgcatatctcttgttttatcaaaaagta
tga

DBGET integrated database retrieval system