KEGG   Botryotinia fuckeliana: BC1G_09152Help
Entry
BC1G_09152        CDS       T01072                                 

Definition
similar to isocitrate lyase 1
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bfu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bfu00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 596 aa AA seqDB search
MFRRIAYVAPRRALSARSSIITVRHLSTSGYRMSSLKALNDPISRPLASDSFQLVPESQK
AGAAEDELYEQQIKEVETWWNSPRYEGIKRPYSAADVVSKRGSQQQSYPSSVMARKLFNL
IKEREANGKPIHTMGAIDPVQMTQQAANQEVLYISGWACSSVLTTTNEVSPDFGDYPYNT
VPNQVQRLAKAQSMHDRKQWDARRKLSKEERAKTPYTDYLRPIIADGDTGHGGLSAVLKL
AKLFAENGAAAVHFEDQMHGGKKCGHLAGKVLVPVGEHINRLVAARFQWDVMGSENLVIA
RTDSESGKLLSSAIDVRDHEFIKGVAEDGIESLAETLQAMELAGATGAEIDIFEAEWVKK
TELMTCDEAVVKQLKEQGVSESSINGYLEATKKDRDMSITKRKDLATKYSKTPIIFNIDI
PRTREGFYHYKAGMEAATKRAIQYAPYADLLWVETGDPNVKNAANFSGEIRAKYPGKGLV
YNLSPSFNWMGHGFTDETLKSFIWDIAKHGFVLQLISLAGLHSTATITSELSKAFKDEGM
LAYVNLIQRREKELGVDVLTHQKWSGASYIDGILGAIQSGSSSSKSMGDGNTEGQF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcagaattgcttatgtggcgccccgcagagctttgtctgcaagaagttcaatc
attactgttcgtcatttatctacctctggctataggatgtccagcttgaaagctctcaat
gacccaatatcgagacctctagcatcggactcattccagctcgtgccggaatcgcagaaa
gctggtgcggccgaggatgaattatacgaacaacaaattaaggaagtggaaacgtggtgg
aatagtccaagatatgaaggaatcaaaagaccatattctgcggcagatgttgtctcgaaa
cgtgggagtcagcagcaatcgtacccaagctccgtcatggcgaggaaactattcaatttg
attaaagagagagaggcgaatggaaagccaatacatacaatgggtgctattgaccctgta
caaatgacccagcaagctgcgaaccaggaagtcttgtatatctccggatgggcatgttct
tctgtacttacgaccacgaatgaggtgtctccagatttcggcgattacccttacaatacc
gtaccgaatcaagtgcaacgattggcaaaagcgcagtcaatgcacgatcgaaaacaatgg
gatgctagaaggaagctgagtaaggaagaaagggcaaagacaccatataccgactatctt
agaccaattatcgcagacggagacacagggcatggcggactttcggctgttctgaagctt
gccaagcttttcgcggagaacggagctgctgctgtacacttcgaggatcaaatgcatggt
ggaaagaagtgcggacatcttgctggcaaagttttagtgcccgtcggagagcacatcaat
cgcttggtggctgcaagattccaatgggatgttatgggctctgaaaacttggtaattgca
cgaacagactccgaaagcggaaagcttctcagtagtgcgattgatgtgcgagatcatgaa
ttcatcaaaggcgtcgcggaagacggtatcgaatcattggcggagactttgcaagccatg
gaattggcaggagctacaggcgccgagattgatattttcgaagccgaatgggtgaagaaa
acggaactcatgacgtgtgatgaagccgttgtcaagcaactgaaggagcaaggtgtctcg
gagtcaagtatcaacgggtaccttgaagctactaagaaagacagagacatgtcgatcacg
aaacgaaaggatttggctacaaagtacagcaagaccccaatcatattcaatattgatata
ccacgaacacgagaaggtttctaccattacaaggctggtatggaagccgctacgaagcga
gcgattcaatacgcaccatatgctgacctcttgtgggttgaaaccggagaccccaacgtc
aaaaatgcagcaaacttctccggcgagattcgtgccaaatacccaggtaaagggctagtc
tacaatctttctccttcatttaactggatgggccatggtttcactgatgaaaccttgaaa
tcattcatttgggatatcgcaaagcatggattcgtgctacaattgatctcgctcgccgga
cttcattctacggcaacaatcaccagcgaattatcaaaagcgttcaaggatgagggtatg
ctcgcatatgtcaacctgatccagaggagagaaaaagagctaggtgtagatgtattgaca
caccaaaaatggagcggtgcatcatatatagatggcattttaggtgctatccagagtggt
agtagcagtagcaagagtatgggcgacgggaataccgaaggccagttttaa

DBGET integrated database retrieval system