KEGG   Botrytis cinerea: BC1G_09152Help
Entry
BC1G_09152        CDS       T01072                                 

Definition
similar to isocitrate lyase 1
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bfu  Botrytis cinerea
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_09152
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1G_09152
Enzymes [BR:bfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BC1G_09152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 596 aa AA seqDB search
MFRRIAYVAPRRALSARSSIITVRHLSTSGYRMSSLKALNDPISRPLASDSFQLVPESQK
AGAAEDELYEQQIKEVETWWNSPRYEGIKRPYSAADVVSKRGSQQQSYPSSVMARKLFNL
IKEREANGKPIHTMGAIDPVQMTQQAANQEVLYISGWACSSVLTTTNEVSPDFGDYPYNT
VPNQVQRLAKAQSMHDRKQWDARRKLSKEERAKTPYTDYLRPIIADGDTGHGGLSAVLKL
AKLFAENGAAAVHFEDQMHGGKKCGHLAGKVLVPVGEHINRLVAARFQWDVMGSENLVIA
RTDSESGKLLSSAIDVRDHEFIKGVAEDGIESLAETLQAMELAGATGAEIDIFEAEWVKK
TELMTCDEAVVKQLKEQGVSESSINGYLEATKKDRDMSITKRKDLATKYSKTPIIFNIDI
PRTREGFYHYKAGMEAATKRAIQYAPYADLLWVETGDPNVKNAANFSGEIRAKYPGKGLV
YNLSPSFNWMGHGFTDETLKSFIWDIAKHGFVLQLISLAGLHSTATITSELSKAFKDEGM
LAYVNLIQRREKELGVDVLTHQKWSGASYIDGILGAIQSGSSSSKSMGDGNTEGQF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcagaattgcttatgtggcgccccgcagagctttgtctgcaagaagttcaatc
attactgttcgtcatttatctacctctggctataggatgtccagcttgaaagctctcaat
gacccaatatcgagacctctagcatcggactcattccagctcgtgccggaatcgcagaaa
gctggtgcggccgaggatgaattatacgaacaacaaattaaggaagtggaaacgtggtgg
aatagtccaagatatgaaggaatcaaaagaccatattctgcggcagatgttgtctcgaaa
cgtgggagtcagcagcaatcgtacccaagctccgtcatggcgaggaaactattcaatttg
attaaagagagagaggcgaatggaaagccaatacatacaatgggtgctattgaccctgta
caaatgacccagcaagctgcgaaccaggaagtcttgtatatctccggatgggcatgttct
tctgtacttacgaccacgaatgaggtgtctccagatttcggcgattacccttacaatacc
gtaccgaatcaagtgcaacgattggcaaaagcgcagtcaatgcacgatcgaaaacaatgg
gatgctagaaggaagctgagtaaggaagaaagggcaaagacaccatataccgactatctt
agaccaattatcgcagacggagacacagggcatggcggactttcggctgttctgaagctt
gccaagcttttcgcggagaacggagctgctgctgtacacttcgaggatcaaatgcatggt
ggaaagaagtgcggacatcttgctggcaaagttttagtgcccgtcggagagcacatcaat
cgcttggtggctgcaagattccaatgggatgttatgggctctgaaaacttggtaattgca
cgaacagactccgaaagcggaaagcttctcagtagtgcgattgatgtgcgagatcatgaa
ttcatcaaaggcgtcgcggaagacggtatcgaatcattggcggagactttgcaagccatg
gaattggcaggagctacaggcgccgagattgatattttcgaagccgaatgggtgaagaaa
acggaactcatgacgtgtgatgaagccgttgtcaagcaactgaaggagcaaggtgtctcg
gagtcaagtatcaacgggtaccttgaagctactaagaaagacagagacatgtcgatcacg
aaacgaaaggatttggctacaaagtacagcaagaccccaatcatattcaatattgatata
ccacgaacacgagaaggtttctaccattacaaggctggtatggaagccgctacgaagcga
gcgattcaatacgcaccatatgctgacctcttgtgggttgaaaccggagaccccaacgtc
aaaaatgcagcaaacttctccggcgagattcgtgccaaatacccaggtaaagggctagtc
tacaatctttctccttcatttaactggatgggccatggtttcactgatgaaaccttgaaa
tcattcatttgggatatcgcaaagcatggattcgtgctacaattgatctcgctcgccgga
cttcattctacggcaacaatcaccagcgaattatcaaaagcgttcaaggatgagggtatg
ctcgcatatgtcaacctgatccagaggagagaaaaagagctaggtgtagatgtattgaca
caccaaaaatggagcggtgcatcatatatagatggcattttaggtgctatccagagtggt
agtagcagtagcaagagtatgggcgacgggaataccgaaggccagttttaa

DBGET integrated database retrieval system