KEGG   Botryotinia fuckeliana: BC1G_09253Help
Entry
BC1G_09253        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bfu  Botryotinia fuckeliana
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bfu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 141 aa AA seqDB search
MISRTQTSEPSDVDLGPDAHAATSLTNALEKLGSRSQAKDSNDGDEKEIDRVFIIGGGQI
YKASLELKEAKRILLTRIMNDFECDTYFPIQLNEDGTGNGWRRTDTQELREWTGEGEVVE
GVKEEGGVKYVFEMWEKIEES
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtcgaacacaaacctctgaaccttcagacgttgatctcggtcctgatgcgcat
gcagcaacaagtttgactaacgcgctcgagaaattgggatcgaggagtcaagcaaaagat
tcgaatgatggcgatgaaaaggagatcgatagagttttcataattggtggagggcagata
tataaagcttcattggaactgaaggaagcaaagagaatattgttgaccaggataatgaat
gattttgaatgcgatacgtattttcctattcaattgaatgaggatgggacgggcaatgga
tggagaaggacggatactcaagaacttagagaatggactggggaaggggaggtggtagag
ggtgtgaaggaggaagggggtgtgaaatatgtcttcgaaatgtgggaaaagattgaggaa
tcatga

DBGET integrated database retrieval system