KEGG   Botrytis cinerea: BC1G_09253Help
Entry
BC1G_09253        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bfu  Botrytis cinerea
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1G_09253
   00670 One carbon pool by folate
    BC1G_09253
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BC1G_09253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 141 aa AA seqDB search
MISRTQTSEPSDVDLGPDAHAATSLTNALEKLGSRSQAKDSNDGDEKEIDRVFIIGGGQI
YKASLELKEAKRILLTRIMNDFECDTYFPIQLNEDGTGNGWRRTDTQELREWTGEGEVVE
GVKEEGGVKYVFEMWEKIEES
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtcgaacacaaacctctgaaccttcagacgttgatctcggtcctgatgcgcat
gcagcaacaagtttgactaacgcgctcgagaaattgggatcgaggagtcaagcaaaagat
tcgaatgatggcgatgaaaaggagatcgatagagttttcataattggtggagggcagata
tataaagcttcattggaactgaaggaagcaaagagaatattgttgaccaggataatgaat
gattttgaatgcgatacgtattttcctattcaattgaatgaggatgggacgggcaatgga
tggagaaggacggatactcaagaacttagagaatggactggggaaggggaggtggtagag
ggtgtgaaggaggaagggggtgtgaaatatgtcttcgaaatgtgggaaaagattgaggaa
tcatga

DBGET integrated database retrieval system