KEGG   Botrytis cinerea: BC1G_09443Help
Entry
BC1G_09443        CDS       T01072                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bfu  Botrytis cinerea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_09443
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1G_09443
   00630 Glyoxylate and dicarboxylate metabolism
    BC1G_09443
Enzymes [BR:bfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1G_09443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 542 aa AA seqDB search
MSQVEAQLQGVNISGSITDLNKKILSKDAVAFLALLHRSFNGTRKELLQRRVIRQAELDK
GSLPDFLPETKHIRENDAWRGAPPAPGLIDRRVEITGPTDRKMIVNALNSNVWTYMADLE
DSSAPTWDNMINGQVNLYDAVRRQVDFKIGEKEYKLRTDRTLPTLIVRPRGWHLEEKHFT
VDGEPISGSLFDFGLYFFHNAKELIASGLGPYFYLPKLESHLEARLWNDVFNLSQDTLAI
PRGTIRGTVLIETILAAFEMDEIIYELRDHSSGLNCGRWDYIFSVIKKFRNNSNFVLPDR
SAVTMTVPFMDAYVKLLIQTCHRRQVHAMGGMAAQIPIKDDKAANDKAMEGVYADKIREA
KAGHDGTWVAHPALASIASEVFNKHMPTPNQMFVRRADVKIGQNDLLNMNVPGAVTEEGI
RKNLNIGLGYMEGWLRGVGCVPINYLMEDAATAEVSRSQLWQWVKHGVSTAEGKKVDKAY
ALRLLKEQADQLASKGAKGNKYQLAAQYFSSQVTGEDYADFLTTLLYNEITAVGQSSPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtcgaagctcagttacagggcgtgaacatttccggatccatcaccgattta
aacaaaaagattctcagtaaagatgcggttgcattccttgctctcctccacagatccttc
aatggaaccaggaaggaattgcttcaacgcagagtaatcagacaagcagaactggataaa
ggttctctaccagatttcctccccgaaacaaaacacatccgagagaatgatgcgtggagg
ggagcaccacctgccccagggttgattgatcgcagagtggaaatcactggtcctacagac
aggaaaatgattgtcaatgctttgaattcaaatgtttggacatatatggccgatctcgaa
gattccagtgctccaacatgggataacatgattaatggacaagtcaatctatacgatgca
gtccgaagacaagtcgatttcaaaataggcgagaaagaatacaagctccgtaccgatcgt
acgctccccacacttatcgtgcgacccagagggtggcatctcgaagagaagcatttcacc
gtagacggcgagcctatctctggtagtcttttcgatttcggtctatactttttccacaat
gccaaagaactcatcgccagtggattgggaccttacttctatctccccaaattggaatct
catctcgaagctcgtctatggaatgatgtattcaatctttctcaagacacgctagctatt
ccccgcggaaccatccgagggacagttttgatcgaaaccattcttgccgcgttcgaaatg
gacgagattatctacgaactccgtgatcacagctccggactcaactgtggacgatgggat
tacatcttcagcgtcatcaagaaattccgtaacaattccaatttcgttctccccgatcga
tcggctgtgaccatgaccgttccattcatggacgcatacgtaaagcttttgatccaaacc
tgtcatcgaagacaagtgcacgccatgggaggaatggccgctcaaatccccatcaaggat
gataaagcggctaatgacaaagccatggaaggtgtgtatgcggataaaatccgtgaagcc
aaagccggacacgatggtacatgggtagcgcatccagccctcgcatcgatcgcctctgaa
gtattcaacaagcacatgcccacgcccaaccaaatgtttgtccgtcgtgccgatgtgaag
attggacaaaatgacctcttgaacatgaatgtcccgggtgccgttaccgaagagggaatt
cgcaagaatctcaacatcggattgggatacatggaaggctggctccgaggcgttggatgc
gtgccgattaattatctcatggaagatgctgcgacggcagaagtgagtcgttcgcaattg
tggcaatgggttaaacacggtgttagcactgcggagggaaagaaagtcgataaggcgtat
gcgttgagattactcaaggaacaggcggatcaattggcgagtaagggggccaagggaaac
aagtatcaattggctgctcaatatttctcgagtcaggttactggagaggattatgcggat
ttcttgactacacttctatataatgaaattaccgcggtgggacaatcatcgcctgcttct
aaattgtag

DBGET integrated database retrieval system