KEGG   Botryotinia fuckeliana: BC1G_09563Help
Entry
BC1G_09563        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bfu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 366 aa AA seqDB search
MVLLKSLVFAGLATVATASSAVIDLIPSNFDQFAFEGKPALIEFFAPWCGHCKTLAPVYE
QLASDFAFAKDKVTIAKVDADAEKSLGKKFGVQGFPTIKYFDGKSKTPEDYNGGRDIDSL
TEFITKKTGVKPKKAKAAPSAVEMLTDKSFKEQIGSDKDVIVAFTAPWCGHCKTLAPVWE
KVASDFANEPNVVIAKVDAEAENSKATAKDQGVTSYPTIKFFPKGSTEAEAYSGGRSEKD
IVEFMNSKAGTHRAVGGGLDATAGTIEALDALVTKFTGGSSIAEVAAEATKAAQEYKEGA
QSKYAEYYVKVFDKLSKSDNYAAKELARLDGIIKKGGLAPEKLDEFTTKTNILRRFIEKA
TGKSEL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggttctcttaaaaagtctcgtgttcgctggcctcgccacagttgctactgcctcatct
gccgttatcgatctcattccttcgaacttcgaccaatttgccttcgagggcaagccagcc
ttgattgaattttttgcaccatggtgcggacattgcaagacccttgcgccagtttacgag
cagcttgcttcggactttgcatttgcaaaggataaggtcacaattgcgaaagtcgatgcg
gatgcagagaagagcttgggcaagaaattcggtgttcaaggtttcccaaccatcaaatac
ttcgacggaaagagcaaaacccctgaggattacaatggaggtagagatatcgatagctta
acagagttcatcacaaagaagactggtgttaagccaaagaaggcgaaggctgccccaagt
gccgtcgagatgttgaccgataagtcatttaaggagcaaattggtagtgataaggatgtc
attgttgctttcactgcaccatggtgtggccactgcaagactttggcgccagtgtgggag
aaggttgcttcggatttcgccaatgaacccaatgtcgttattgccaaggtcgatgccgaa
gcagaaaactccaaagcaacagccaaggaccaaggcgttacctcttaccccaccattaag
ttcttccccaagggaagcactgaagccgaagcatactctggtggacgttccgagaaggac
attgtcgaattcatgaatagcaaggccggtacacaccgtgctgttggcggtggactcgat
gccactgctggtactatcgaggctttggacgctctcgtcaccaagtttactggtggttca
agcattgctgaagtcgccgcagaagctaccaaggctgctcaagaatacaaggagggcgct
caatccaagtacgctgagtactatgtcaaggtctttgacaagttgagcaagagtgataac
tacgccgcaaaggagcttgctagattggatggtatcatcaagaagggaggcttggcacca
gagaagttggatgagttcacaaccaagaccaacatcttgagaagattcatcgagaaggcg
accggaaagtctgaattgtag

DBGET integrated database retrieval system