KEGG   Botrytis cinerea: BC1G_09604Help
Entry
BC1G_09604        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
bfu  Botrytis cinerea
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BC1G_09604
Enzymes [BR:bfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     BC1G_09604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 485 aa AA seqDB search
MNSTSPIDTIEDGTNEAASEWAHQNGDSVIHIEKKLDNSTEFPARPMMGKRKAKRKDDSP
LDIICKFVVDHQTGLSVNLLMLLSLTHMCFPRARRHTRKFFELSYYNPESGEYCAGWNDA
WLVFYWIVIFTGLRAAFMDYVLRPLARKGGVKNARDETRFAEQAWLMIYYSVFWTLGMYI
YVNSDYWWNLSELWTNWPNREVGGLRKWYILVQYAFWLQQIIVINIEARRKDHWQMFAHH
IVTTALIFTSYGYHQTKVANVILCLMDVVDLFFPVAKCLKYLGYDRLCDLMFGLFMLSWV
TARHAFYLIICYSVWADIPRVINYGCYQGKNGSISGPFPPPDRFGHLFKPFQDPVGVVCW
NNNIKWGFLSALLFLQGITLMWFWMIVQVAIKVIRGGQADDTRSDNEEEEEEDIDLDEEP
FPEEVPLLEKEPYEEEVGVEELNLEKRTSKNSRYKKTTSSASGVSIPGHSDRKELLGRIG
CDKGV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaactctacttctccaatcgatacgattgaagatgggacaaacgaagctgcgtcagag
tgggcacatcaaaatggagactctgttattcatatagagaagaaactggataattcaacg
gaatttccagctcgtccaatgatgggcaaaagaaaggccaaaaggaaagatgatagtccc
ctggatatcatttgcaaatttgttgtggaccatcaaactggactatctgtcaatcttttg
atgctcctttccttaacgcacatgtgctttccaagagcccgcagacatactcgcaaattc
ttcgagctttcctactacaatccagaatctggcgagtattgcgccggttggaatgatgct
tggttagtgttctattggattgttatcttcacaggacttcgcgctgctttcatggattat
gtattaagaccattggcaagaaagggtggggtgaagaacgcgagggatgagacgagattt
gctgagcaggcttggcttatgatctattattctgtgttctggacactgggaatgtatata
tacgtcaactcagactactggtggaatttgagcgagctatggactaattggcctaatcga
gaggttggtgggcttcgaaaatggtatatcctcgtccaatatgccttctggcttcagcag
attattgtcatcaatatcgaggcacgtcgaaaggatcattggcaaatgtttgctcaccat
atcgttacaactgcgttgattttcacaagttatggttatcatcaaacgaaagttgcaaat
gtaattctttgtttgatggacgtagtagatcttttctttccagttgcaaaatgtctcaaa
tacctcggatacgatagattatgcgatttgatgttcggacttttcatgctctcgtgggta
acagcccgtcatgctttctatcttatcatttgctattcggtttgggcggatattccaagg
gtgatcaattatggttgttaccagggtaaaaacggttctatctcaggtcctttcccgcct
cctgatcgctttggacacctcttcaagccatttcaagatccagtcggagttgtttgttgg
aataataacattaaatggggcttccttagtgccttgcttttccttcaaggtatcacacta
atgtggttctggatgattgttcaagttgctatcaaagtcatcagaggtggccaagcagat
gatacacgaagtgacaacgaagaggaagaagaggaagatatcgatttggatgaggaaccc
tttcccgaggaagttcctctgttagaaaaagagccatatgaggaagaagtcggcgtcgaa
gaattgaatttggagaaaagaacatcgaaaaatagtcgatacaagaagactacgagcagt
gcaagtggcgtaagcatcccaggacacagcgatagaaaggaattgctgggaaggattggt
tgtgataaaggcgtttag

DBGET integrated database retrieval system