KEGG   Botryotinia fuckeliana: BC1G_10119Help
Entry
BC1G_10119        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 252 aa AA seqDB search
MAEAIDNPDVPSNKKAFIPLENNPEVMSSLLHKLGLSTTLSFHDVFSIEDPSLLSFIPRP
ALALLLVFPVSKSYEAFRFTEDKEREDYKGKGESEPVIWYKQTIRNACGLIGLLHAVSNG
AARGFVEQDSPLDKLIKDAIPLAAIDRADLLYNSQALESAHQSAATQGQSSTPNAEDDID
LHYVCFVKDENNNLWEMDGRRRGPLELGSLGEDEDVLSEKALDWGVRKFLKREEANGAEL
RFSLIALAPSLD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcaatagataatccagatgtcccttcaaacaagaaggctttcattccctta
gagaataaccccgaagtaatgtcctctctcctccataaactcggtctctccaccactctt
tctttccacgacgtgttttccatcgaagatccctctctcctctcctttatccctcgtccc
gcactcgccctcttgctcgttttccccgtctcaaaaagttacgaggcatttcgctttaca
gaggataaagagcgcgaagattataaaggaaagggggagagtgaaccagtcatttggtat
aaacagactatcaggaatgcgtgtggattgatcggccttttgcacgctgtaagcaatggt
gctgcgaggggttttgttgaacaagactctcctctcgacaaactaatcaaagatgcaatt
cctctcgccgcaatcgatcgcgcagatctcctctacaattcccaagctctcgaatctgcc
catcaaagtgccgccacacaaggccaatcctccacgcccaatgccgaagatgacatcgat
ttacactacgtatgtttcgtcaaggacgagaataacaacctttgggaaatggatggaagg
agaagaggcccacttgagttgggatcattgggagaagatgaagacgttttgagtgaaaag
gcgttggattggggtgtaaggaagtttttaaagagagaagaggcaaatggcgcggaattg
aggttcagtttgattgcgttagcaccaagtcttgactaa

DBGET integrated database retrieval system