KEGG   Botrytis cinerea: BC1G_10247Help
Entry
BC1G_10247        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
bfu  Botrytis cinerea
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BC1G_10247
   00500 Starch and sucrose metabolism
    BC1G_10247
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BC1G_10247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 511 aa AA seqDB search
MFRLTSLAVTLLAAVSSAQETNSTSATSSTSTFDSSVPTDAPLPDNPTETVAGNQHWGHA
TSKDLYHWDNQKIALYPENADEGIFSGSAVVDANNTSGFFPNQTNGVVALYTLNTPESET
QNLAYSFDGGYTFEKYAQNPVIPSTSTQFRDPQVTWFEDHWVMVVAYARAFEIGIFTSPD
LIEWTATSNFSHHGLLGLQYECPNLVRIPVTDSTDDEDMYLLIISINPGAPLGGSTTQYF
PGRFNGTHFTPLDSAARLTDFAKDNYAGQFFSGIPADEDPVFLAWASNWEYAQQVPTGEL
EGWRSAMSLPRRTRLANVTRTGWALIQYPFDLTPLYNESEPLASSDNLGNGSLIADYSSI
PSGAIYISCKVTSMPNNTLAQGTLNFTFSSSTTRESVSGGIFLGGDAPVWLSRRNFNGFA
ESNPFFTDRFSVGNTINDEGTFQFDVVIDRSILEVFVDAGRSSGTITFFPEGILDTVEVR
AGDLNEGVVVDAKIWGLDGGWSAMANDDGIV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcttacttcattagccgttactcttctggccgctgtatccagtgcgcaggaa
acgaattcaacgtcggcaacttcctcaacttcgacgtttgatagcagcgttccaaccgat
gcacctctaccggacaacccaacagaaactgtagccggaaaccaacattggggccacgcg
acatccaaagatctctaccactgggacaaccaaaaaattgcgctctaccctgaaaatgct
gacgaaggaattttcagtggaagtgcagtggtcgatgcaaacaacacctctgggtttttc
ccgaaccaaacgaacggtgtagtcgcgctttacactctcaacacccctgagtctgagacc
caaaatctcgcatactctttcgatggtggctacacttttgagaaatatgcacaaaaccct
gtcatcccatctacctcgactcaattccgtgacccccaagtcacatggttcgaggaccat
tgggtgatggtagttgcctatgctcgggccttcgaaatcggtatcttcacctcccctgat
ctcatagaatggaccgccacctccaatttcagccaccatggtcttctaggcctccaatac
gaatgtccaaatctagtgcgcatccccgtcaccgacagtaccgacgatgaagacatgtat
ctccttattatctccatcaatccgggtgcacctctcggcggttccacaacccaatatttc
cccggtagattcaatggaacacatttcacccctctcgattccgcagcccgtcttaccgac
ttcgcaaaagacaactacgcaggacaatttttctccggaattccagcagatgaagacccg
gttttcttggcctgggccagcaattgggaatacgcacaacaagtcccaaccggagaactc
gaaggctggcgcagtgccatgtctctaccccgccgtacccgtctcgcaaacgtcacacgt
acaggctgggctctcatccaatatccattcgacttgacgcccctctacaacgaatccgaa
cccctagcctcgagtgacaatctcggaaacggaagtctcatcgctgactactcgtcaatt
cccagcggcgcaatctacatcagctgcaaggtaaccagcatgcccaacaacactctcgcg
caaggaaccctaaacttcaccttctcctcctctaccacccgtgaatccgtctctggaggc
atcttcctcggaggcgacgcgcccgtctggctttcccgccgcaacttcaacggattcgca
gaatccaaccccttcttcaccgatcgattctccgtcggaaacaccatcaacgacgaagga
actttccaattcgacgtcgtcatcgatcgatccattctcgaagtcttcgtagacgcagga
agaagcagtggaaccattacattcttccccgagggaatcttggacacggtcgaagtgaga
gccggagaccttaacgagggtgtggtcgtagatgccaagatctggggcttggatggcggc
tggagcgcgatggctaatgatgatggcattgtatag

DBGET integrated database retrieval system