KEGG   Botryotinia fuckeliana: BC1G_10410Help
Entry
BC1G_10410        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
bfu  Botryotinia fuckeliana
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:bfu04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 220 aa AA seqDB search
MKQVEHTNDERKMLQEVKHPFLITLWGTFQDSKNLYMVMDFVEGGELFSLLRKSQKVPDI
TWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLCGFTPFWDGGSPMKIYENILKG
RVKYPPYIHPDAQDLLQRLITADLTKRLGNLHGGSEDVKNHQWFAEVTWERLSKKDIDAP
YVPPVKAGVGDASQFDKYPEETEIYGQGGPDEFGHLFVDF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggtcgaacataccaatgatgagagaaagatgttgcaggaagtcaaacatcca
ttcctcattactctatggggtacttttcaagactcgaagaatttatacatggtcatggac
tttgtagaggggggtgaactattctctttactgcgaaagtcacaaaaggtcccagatatt
acatggacattgtgtggtactccggattacttagcaccagaagtggtctcgagtaaaggt
tataataaatcggtagattggtggtcccttggtatattaattttcgaaatgctttgtggt
tttacaccgttttgggatggtggctctcccatgaaaatttatgagaatattcttaaaggg
agggttaagtatcctccctacattcacccagatgcacaggacttgttgcaaagattgatc
acagcagatctcaccaagcgtcttggtaacttacatggtggttctgaggatgtaaaaaat
catcaatggttcgctgaagtaacttgggaaaggttatccaaaaaggatatcgatgcacct
tatgttcctcctgttaaggctggagttggagatgccagtcagtttgataagtaccctgaa
gaaacggagatatatggtcaaggtgggcccgatgaatttgggcacctattcgtggatttt
taa

DBGET integrated database retrieval system