KEGG   Botryotinia fuckeliana: BC1G_10557Help
Entry
BC1G_10557        CDS       T01072                                 

Definition
similar to UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bfu  Botryotinia fuckeliana
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bfu00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfu00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 525 aa AA seqDB search
MAQALKSALPSHLKPSSLSPNDNGEFARKHHGKTQSHMAFENTSTSVAASQMRNALNNLA
DTVEDPEEKKLFETEMDNFFALFRRYLNDKAKGNQLDWDRIAPPAQNQVVDYNALANSES
VGFLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYNVNVPFVL
MNSFNTDDDTSNIIKKYEGHNIDILTFNQSRYPRILKDSLLPAPKTFDSQISDWYPPGHG
DVFESLYNSGILDTLIKRGVEIVFLSNVDNLGAVVDLRILQHMVETKSEYIMELTDKTKA
DVKGGTIIDYEGSVRLLEIAQVPKEHTNEFKSIKKFKYFNTNNIWLNLQAVKRIVENNEL
EMEIIPNNKSIPADKKGESDVSIVQLETAVGAAIRHFHNAHGVNVPRRRFLPVKTCSDLM
LVKSDLYSLKHGQLQIDPSRFGPAPLIKLGNDFKKVSDFQKRISSIPRILELDHLTITGA
VNLGRGVTLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagcattgaaaagcgctctcccctcccacctcaagccttcgagcttatctcca
aacgataatggcgaattcgcccgcaagcaccatggaaagacacaatcacacatggctttc
gagaacacctcaacatctgtagctgccagtcagatgagaaatgctctcaacaacctcgca
gacaccgttgaggaccccgaagagaagaagctcttcgagaccgagatggacaacttcttc
gctcttttccgcagatacttgaacgacaaggcaaagggaaaccaacttgactgggatcgt
attgccccacctgcccaaaaccaagtcgtcgattacaacgcgctcgcaaactccgagtcg
gttgggttccttaacaaattggctgttctcaagctcaatggaggtcttggtacttccatg
ggttgtgttggtccaaaatcagtcatcgaggtccgtgacggcatgtccttcctcgatctt
tccgtcagacaaatcgaatacctcaaccgcacatacaacgtcaacgtccctttcgttttg
atgaactcattcaacactgatgatgatacctcaaacatcatcaagaaatacgagggacac
aacattgacattcttacattcaaccaatctcgatacccaagaatcttgaaggactccctc
cttcctgcaccaaagacattcgattcccaaatttctgactggtacccaccaggacacgga
gatgttttcgagtctctctacaactccggcatcctcgataccctcatcaagagaggtgtt
gagattgttttcctttccaacgttgacaacttgggtgctgttgttgatctccgcatcttg
caacacatggttgagaccaagtctgaatacattatggagttgaccgacaagaccaaggcc
gatgtcaagggtggtaccatcattgattacgaaggttccgttcgtcttctcgaaattgct
caagtaccaaaagagcacaccaacgagttcaagtctatcaagaaattcaagtacttcaac
accaacaacatctggttgaacttgcaagctgttaagcgtattgtcgagaacaacgagctc
gagatggagatcattccaaacaacaaatccatcccagcggataagaagggcgagtctgat
gtctcgatcgttcaactcgagactgccgtcggagctgctatccgtcatttccacaacgct
cacggtgtcaatgtaccccgtagacgtttcttgccagtcaagacctgctctgatttgatg
cttgttaagtcagacttgtactctttgaagcacggtcaacttcaaattgaccccagccgt
ttcggcccagctcctttgatcaagctcggtaacgacttcaagaaggtatccgatttccaa
aagcgtatcagcagcatcccaagaattcttgagcttgatcacttaaccattactggagct
gtcaaccttggcagaggtgtcactctcaagggtactgttattattgtagcaactgaagga
caaactatcgacattcctcccggatccatcttggagaacgtcgtggtacaaggttccttg
agacttttggagcattag

DBGET integrated database retrieval system