KEGG   Botrytis cinerea: BC1G_10609Help
Entry
BC1G_10609        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
bfu  Botrytis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BC1G_10609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 360 aa AA seqDB search
MAGLFGSAATTTSTSAANTLGDLSKDIPLNNPPEDSISDLAFSPVSEHLAVASWDKKVRI
YEILPSGQSEGRALFDFEGPVFSCHWSKDGKKVVGAGADKTARVMDLESNQTVSQVAAHD
QPIKSARFFTAPQTNGEMLVTGSWDNTIKYWDLRTPNPVISVNMNHKVYTLDVQKNVLVV
GTADRFINIIDLNMPDKIKKTIQSPLKWQTRVISLFPDASGFAVGSIEGRCAIQYVEDKD
ASMNFSFKCHRDPPSNNMTNVYSVNAISFHPIHGTFSTAGSDGTFHFWDGIAKHRLKGYP
TVGGTISATAFNHTGNIFAYAVSYDWSKGYASNTPQYPNKIMLHPVNADECKPRPSVKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccggactatttggttctgcggctaccacaacctcgacgagcgcggccaatactctc
ggtgacctttcgaaagatatccctctcaataatcctcccgaggatagtatttccgatctt
gccttttcgccggtttccgaacatctagccgtcgcatcatgggataagaaagtgaggatc
tatgagatcttgccgagcgggcagagtgaaggcagggcattatttgacttcgaggggccg
gtctttagttgtcactggtcaaaggatggaaagaaagtagtcggagccggagcagacaaa
actgcgcgtgttatggatcttgaaagcaatcaaacggtatcgcaagtcgccgcgcatgat
caacctataaaatccgcgagattcttcactgcccctcaaacaaacggcgagatgcttgtg
accggatcttgggataacaccattaagtattgggatttgagaactcccaacccggtcatt
tcggtgaacatgaaccacaaagtctataccttagatgtccagaagaatgttttggttgtt
ggaaccgcagaccgatttatcaatattatcgacttgaacatgccagataagattaagaag
accattcaaagtccgttgaaatggcaaactagagtcattagcttatttcccgatgcttct
ggtttcgctgttggcagtattgaaggaagatgtgccattcaatatgttgaagacaaggac
gccagcatgaacttctctttcaaatgtcaccgcgacccaccctcaaacaacatgaccaat
gtctactccgttaacgcgatatctttccaccccatccacggcaccttcagcactgctggc
tccgacggcacgttccatttctgggacggaattgccaagcatagattgaagggttaccca
accgttgggggaaccatctccgctacagccttcaaccacaccggaaacatttttgcctat
gccgttagttacgattggagtaagggttatgcaagcaacacaccacaatatccaaataag
attatgttacatccagtaaatgcggatgagtgcaagcctagaccaagtgtcaagaagagg
tag

DBGET integrated database retrieval system