KEGG   Botryotinia fuckeliana: BC1G_10609Help
Entry
BC1G_10609        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
bfu  Botryotinia fuckeliana
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:bfu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 360 aa AA seqDB search
MAGLFGSAATTTSTSAANTLGDLSKDIPLNNPPEDSISDLAFSPVSEHLAVASWDKKVRI
YEILPSGQSEGRALFDFEGPVFSCHWSKDGKKVVGAGADKTARVMDLESNQTVSQVAAHD
QPIKSARFFTAPQTNGEMLVTGSWDNTIKYWDLRTPNPVISVNMNHKVYTLDVQKNVLVV
GTADRFINIIDLNMPDKIKKTIQSPLKWQTRVISLFPDASGFAVGSIEGRCAIQYVEDKD
ASMNFSFKCHRDPPSNNMTNVYSVNAISFHPIHGTFSTAGSDGTFHFWDGIAKHRLKGYP
TVGGTISATAFNHTGNIFAYAVSYDWSKGYASNTPQYPNKIMLHPVNADECKPRPSVKKR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccggactatttggttctgcggctaccacaacctcgacgagcgcggccaatactctc
ggtgacctttcgaaagatatccctctcaataatcctcccgaggatagtatttccgatctt
gccttttcgccggtttccgaacatctagccgtcgcatcatgggataagaaagtgaggatc
tatgagatcttgccgagcgggcagagtgaaggcagggcattatttgacttcgaggggccg
gtctttagttgtcactggtcaaaggatggaaagaaagtagtcggagccggagcagacaaa
actgcgcgtgttatggatcttgaaagcaatcaaacggtatcgcaagtcgccgcgcatgat
caacctataaaatccgcgagattcttcactgcccctcaaacaaacggcgagatgcttgtg
accggatcttgggataacaccattaagtattgggatttgagaactcccaacccggtcatt
tcggtgaacatgaaccacaaagtctataccttagatgtccagaagaatgttttggttgtt
ggaaccgcagaccgatttatcaatattatcgacttgaacatgccagataagattaagaag
accattcaaagtccgttgaaatggcaaactagagtcattagcttatttcccgatgcttct
ggtttcgctgttggcagtattgaaggaagatgtgccattcaatatgttgaagacaaggac
gccagcatgaacttctctttcaaatgtcaccgcgacccaccctcaaacaacatgaccaat
gtctactccgttaacgcgatatctttccaccccatccacggcaccttcagcactgctggc
tccgacggcacgttccatttctgggacggaattgccaagcatagattgaagggttaccca
accgttgggggaaccatctccgctacagccttcaaccacaccggaaacatttttgcctat
gccgttagttacgattggagtaagggttatgcaagcaacacaccacaatatccaaataag
attatgttacatccagtaaatgcggatgagtgcaagcctagaccaagtgtcaagaagagg
tag

DBGET integrated database retrieval system