KEGG   Botrytis cinerea: BC1G_10994Help
Entry
BC1G_10994        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfu  Botrytis cinerea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_10994
   01230 Biosynthesis of amino acids
    BC1G_10994
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_10994
   00030 Pentose phosphate pathway
    BC1G_10994
   00051 Fructose and mannose metabolism
    BC1G_10994
   00052 Galactose metabolism
    BC1G_10994
  Energy metabolism
   00680 Methane metabolism
    BC1G_10994
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BC1G_10994
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BC1G_10994
Protein phosphatases and associated proteins [BR:bfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BC1G_10994
Messenger RNA biogenesis [BR:bfu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BC1G_10994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 516 aa AA seqDB search
MIKDLLADKNGLALDTRISTLGHVQRGGSACAYDRYLSTLQGIEAVNAVLDATPETVTPF
IAINENKITRKPLVQSVIDTQEVAKAIEAKDFERAMALRDTEFSDFYDSYMTTTATDLNN
EMRLPDKKHMRIAIVHVGAPAGGVNAATRAAVAYCLTRGHTPIAIHNGFAGFARHHQDNP
GSVREFDWLEVDGWASKGGSEIGMNRELPSESGMPLIASLFEKFKIDGLLIIGGFEGFHA
LSELRQARETYSSLCIPMTLLPATISNNVPGTEYSIGSDTCLNELVRYCDTIKQSASASR
RRVFVIETQGGRSGYVATMAGLAVGASAVYTPEEGVSIGMLSADIAHLKEVFEQDSGQSR
AGRLILINEKASKVYNAKLIADMIREEARDRFESRDSIPGHVQQGGTPSPMDRTRAVRLA
IKCIEHLEQYEDRTDKKILGDKQSSTVIGIKGAQVVFSSMVDVEENETDWPNRRPKDEFW
LDLKGTVDILAGRPDVPRPERKLKGWKAKDSKRGLI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggatcttcttgcagacaagaatggtctcgctcttgatacacgtatttcaaca
ttgggtcatgttcaacgtggtggttctgcatgcgcttacgatcgatacctttctacttta
caaggcatcgaagcagtaaatgctgttcttgatgctaccccagaaacggtcactcctttt
atcgccattaacgaaaacaaaatcaccagaaaaccactggttcaatccgtcattgatact
caagaagtagcaaaggctatcgaagcaaaggatttcgagagagctatggcactcagagat
acagagttttctgacttttatgattcctacatgactacaacagctactgatctcaacaat
gaaatgcgtcttcctgataagaagcacatgagaattgctattgtgcatgtcggagctcca
gctggtggtgttaatgctgctacgcgtgcagctgttgcttattgcttaactcgtggacat
acaccaattgctattcataatggtttcgctggattcgcccgtcatcaccaagataaccca
ggatcggttcgagaatttgattggctagaagttgatggatgggctagtaagggtggttca
gaaattggtatgaaccgtgaacttccatcggaatctggaatgccattgatcgcatcactt
tttgaaaaattcaagattgatggtcttctcattattggaggtttcgaaggtttccatgcc
ttgtccgaacttcgtcaagcaagagaaacttactcttctctttgcattcctatgacttta
cttccagccactatctccaataatgttccaggaacagaatattcgattggttcagatact
tgtttgaacgaacttgtccgttattgcgataccattaaacaatccgcttcagcttcccgt
cgtcgtgttttcgtcattgaaacccaaggtggtcgatctggttacgttgctaccatggct
ggtctcgctgttggtgcatcagctgtctatactcctgaagaaggtgtcagtattggtatg
ctctcagcagatatcgcacatctcaaggaagttttcgagcaagacagtggtcaatcaaga
gctggccgtcttatcctcatcaacgaaaaagcatcaaaggtttacaacgctaaactcatc
gctgatatgatccgtgaagaagctcgcgatcgtttcgaatccagagatagtatcccaggt
cacgttcaacaaggtggtactccatcccctatggaccgtacccgagccgttcgcttagct
atcaaatgtattgaacatctcgagcaatatgaagatagaaccgataaaaagattcttggg
gataaacaaagttcaacagttattggcattaagggtgcacaagttgtattctctagtatg
gttgatgttgaggaaaatgaaacggattggccaaatagaagaccaaaggatgagttctgg
ttggatttgaagggaactgtggatattcttgctggtagacctgatgttcctagaccggag
cgtaaattgaagggttggaaggcgaaggatagtaagaggggtttgatttga

DBGET integrated database retrieval system