KEGG   Botrytis cinerea: BC1G_11186Help
Entry
BC1G_11186        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bfu  Botrytis cinerea
Pathway
bfu00600  Sphingolipid metabolism
bfu01100  Metabolic pathways
Module
bfu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BC1G_11186
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     BC1G_11186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 5430923
NCBI-ProteinID: XP_001550414
AA seq 483 aa AA seqDB search
MASSMDSNHPFIDTMGITSDEYVREQAFVTDGTLTVGRNASLTLGTDSLIVLDTKELAIR
YAAPTSKTRVQATELKYAIESNSTEEVEKWIAKLLDRSYGESQQTKRAKVLVNPHSGKGK
AQKYYDRDVEPLLKAANCSIDMVKTKFQGDAVTIVEDMDVEAYDMVVCCSGDGLAHEVFN
GLGKRHDAKKALSKIAVTHVPCGSGNAMSMNLNGTASASLATLAIIKGIPTPLDLMSITQ
GETRTISFLSQSVGIVAEADLATEHLRWMGSARFTYGFLERLIGQAIYPCDIAVKVAIED
KPSIKDYYRKEMSNREPASERRGYKHLLDDDASASSGTDDGLPPLRYGTVSDKLPEGWEM
VPYDKLGNFYCGNMAYMASDANFFSAALPSDGYMDLVCINGDISRLSAIKMMLSVESGKL
FDIPDVWYRKILGYRIIPKQKGDGYISIDGERVPFQPFQAEVHKGLGTVLSKTGHMYEWH
GPI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctatggattcaaatcatccgtttatcgatacgatgggaattactagtgac
gaatatgtgcgggaacaggcgtttgtgactgatgggacgttgacggtaggaaggaatgct
tccttgaccttgggaacggactctttgatcgtgcttgacacgaaagagcttgcgattcga
tatgctgcacctacatcaaaaacgagggtacaggccacggagttgaaatatgcgattgaa
tcaaattctacggaagaagtcgagaaatggatagcaaaattactagatcgatcgtacggc
gaatcgcaacaaacaaaacgagcaaaggtcctggtgaaccctcatagtggcaaaggaaag
gcgcagaaatactatgatcgggatgtggaaccccttctgaaggcagcgaattgtagtatc
gacatggtaaagacgaaatttcagggagatgcggttacgattgtcgaggatatggatgtc
gaagcttatgacatggtggtttgctgttccggagatggattagcgcatgaggtgtttaac
ggcctgggaaagagacatgatgcgaaaaaagccctatcgaagattgcagtgacgcatgta
ccatgcgggagtggaaatgctatgagtatgaatttgaacggaactgccagtgcgagtttg
gctactttggctatcatcaaggggattcccacgccgctggatcttatgtcgatcacacaa
ggagaaacacgaacaattagtttcctatctcagtctgtagggattgtggccgaggctgat
ttagctaccgaacatttgagatggatgggaagtgcacgatttacgtatggatttctagag
agacttattggacaagcaatttatccttgtgatattgctgtcaaggttgcgatagaagat
aaaccaagtataaaagattattatagaaaggagatgagcaatcgcgaaccggcaagcgag
aggagaggatacaaacacctattagacgatgatgcttcggccagtagtgggacggatgat
ggattgcctccgctgagatatggtactgtaagcgacaaattaccggagggctgggaaatg
gttccctacgataaattgggcaatttctactgtggaaatatggcatacatggcctcagat
gccaatttcttctccgccgcccttccaagtgacggttacatggacctcgtttgcatcaac
ggcgatataagtcgtctttcagctatcaagatgatgttgtccgtagagagtgggaaactg
tttgacattcctgatgtatggtatcgtaagatcctaggatatagaatcattccaaaacag
aaaggggatggatacattagcattgatggggagagggttccttttcaaccatttcaagcc
gaggtacataagggattgggtacggtactctcgaaaacaggacatatgtatgagtggcat
ggtcctatttaa

DBGET integrated database retrieval system