KEGG   Botrytis cinerea: BC1G_11289Help
Entry
BC1G_11289        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
bfu  Botrytis cinerea
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BC1G_11289
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1G_11289
   00640 Propanoate metabolism
    BC1G_11289
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BC1G_11289
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    BC1G_11289
Enzymes [BR:bfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BC1G_11289
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BC1G_11289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1241 aa AA seqDB search
MEHILRSSVVESRYGETGWEHREPDIEVLKEVVDSKYTVFDVLPIFFGHSDPWVSLAALE
VYIRRAYRAYSLKKIEYHNESSDPPFIVSWDFVLRKVGASEFGMPVQSSAPSTPATPSHE
SGNPFKRVSSISDMTYLTNKPDHEPTRKGVIVPVQYLDEAEEYLQRALEVFPVSGAKKKG
NGLLPELGGKRKVAPPRIDTEDELTAVCNVAIQDAESLDDNETVAKIKLIVNDYKEELLN
RRIRRLTFICGHKDGSYPGYYTFRGPNYEEDESIRHSEPALAFQLELGRLSKFKITPVFT
ENRNIHIYEAVGKEATSDKRYFTRAVVRPGRLRDEIPTAEYLISESDRLMNDILDALEII
GNNNSDLNHIFINFSPVFPLQPPEIEQALGGFLERFGRRLWRLRVTGAEIRIICTDPSTG
MPYPVRVVITNTSGYVIQVEMYAERKSEKGGEWVFQSIGGTTKIGSMHLRPVSTPYPTKE
WLQPKRYKAHLMGTQYVYDFPELFRQAIQNSWVKAVRKHSSLADKQPPTGECIEYSELVL
DDNDGLAEVSREPGTNTHGMVGWLITAKTPEYPRGRKFIIVANDITFRIGSFGPKEDQFF
HKCTELARKMGIPRIYLSANSGARIGMAEELMPYFKVAWKNPERQEAGFKYLYLDTEAKK
RFEDGKSKDVITEEVVEDGETRHKIVTIVGAEDGLGVECLKGSGLIAGATSRAYEDIFTI
TLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYK
NGVSHMTANDDFEGVSKIVEWMAYVPDKRNSPLPIGPAADSWDRDIVYTPPEKQPYDVRN
LIAGKDDDEGFMPGLFDKDSFVETLGGWAKTVVVGRARLGGIPMGVIAVETRSVENITPA
DPANPDSTEQISNEAGGVWYPNSAFKTAQAIKDFNNGEQLPLMILANWRGFSGGQRDMYN
EVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVVDPTINPEFMEMYADEDSRGGVL
EPEGIVNIKYRKDKQLETMARLDPEYAELKKQLLDNAAGQEKLAEIKVKVEQREKALLPV
YNQISLQFADLHDRAGRMKAKGVIRESLKWREARRFFYWRVRRRVNEEYILKRMLSANSK
SPTGTRPENLRKLAAWTAIPAFQTDDKSVAMWYEENRKVVHEKVEQMKIEGVAAEVSALL
RASGPSAKGGLSGGAMAGIRQVLSMLPVEEREEALKFLGRP
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccttcgatcttcggttgttgaatcaagatacggtgagaccggatgggaa
catagagaacctgatattgaggttctcaaggaggttgttgattctaagtacactgtcttt
gacgttttgccaattttcttcggacatagcgatccttgggtctctctcgcagctctcgaa
gtatatattcgtcgtgcctacagagcatactccctcaagaagattgagtaccacaacgag
agttctgaccctcctttcattgtctcatgggactttgtcttaagaaaggttggagcttcg
gaatttggcatgccagttcaatcctctgccccttcgacaccagccaccccttcgcatgaa
tccggcaacccatttaaacgcgtcagctctattagtgacatgacctaccttaccaacaag
cctgaccatgagccaacaagaaagggtgtcattgtaccagttcaatatctcgacgaagcc
gaggagtacttgcaacgggcccttgaggtcttccctgtctctggagctaagaagaagggc
aatggtcttttgccggaacttggtggcaagcgcaaggtcgcacctccccgcatcgatact
gaggatgagcttactgccgtctgcaatgtcgccattcaagatgctgagagtcttgatgac
aacgagactgttgctaagatcaagctgatcgtcaacgactacaaggaggagcttctcaac
cgtcgcattcgtcgtcttacattcatctgtggccacaaagatggttcgtaccctggatac
tacactttcagaggccccaactacgaggaagatgagagtattcgtcacagtgagcccgct
ttggctttccaacttgagttaggaagactttccaaattcaagattaccccagttttcact
gaaaacagaaacatccacatctatgaggcagttggaaaggaagctacaagcgataagaga
tactttactcgtgctgtcgtgcgtcctggaagacttcgtgatgagattcctacagctgag
tatttgatctctgagtccgatcgattgatgaatgatattttggatgctcttgagatcatt
ggaaacaacaactctgatcttaaccacatcttcatcaacttctctcctgtcttccctctt
caaccccccgagatcgaacaagctcttggcggcttcttggagcgattcggtagacgtctt
tggagactccgtgtcactggtgctgagatccgtatcatctgcacggatccatccactggc
atgccatatccagttcgtgttgtcattaccaatacctctggttacgtcatccaagtcgag
atgtatgctgagcgtaaatctgagaagggtggtgaatgggtcttccaaagtatcggtggt
accaccaagattggttccatgcacttgagaccagtatctactccataccccaccaaggaa
tggttgcaaccaaagagatacaaggctcatctcatgggtactcaatacgtatacgatttc
ccagagctttttagacaagccattcaaaacagttgggtcaaggctgtccgcaagcactct
tctttggccgacaaacaacctcctactggtgaatgtatcgagtacagtgaactcgtttta
gatgacaatgatggtctcgccgaggtttcgcgtgaacctggtactaacactcacggtatg
gttggttggctcatcactgccaagacaccggaatatcctcgtggccgtaaatttatcatt
gtcgccaacgatatcactttcagaatcggtagtttcggaccaaaagaagatcaattcttc
cacaagtgcacggaactcgcaagaaagatgggtattccacgtatctacttgtctgccaac
tctggtgctcgtattggtatggctgaagaacttatgccttacttcaaggtggcctggaag
aaccctgagagacaagaagccggcttcaaatatctttacttggatactgaagccaagaag
agatttgaagatggtaagagcaaggatgtcatcactgaggaggttgttgaggatggtgag
acaagacataagatcgttactatcgttggtgctgaagatggtcttggtgttgagtgtttg
aagggttctggtttgattgccggtgccacttcaagagcttacgaagatatctttaccatc
actttggtaacttgtcgttcagttggtatcggtgcatacttggttcgtcttggtcaacgt
gctattcaaattgaaggacaaccaatcatcctcactggtgcccctgccatcaacaaactt
ctcggtcgtgaagtttatacttccaacttgcagcttggtggtacccaaatcatgtacaag
aatggtgtctctcacatgactgccaatgatgattttgagggtgtctccaagattgttgaa
tggatggcttacgttccagacaagagaaacagccctctaccgatcggacctgctgctgac
tcttgggatcgtgatattgtttacactccaccagaaaagcaaccttatgatgttagaaac
ctcatcgctggtaaggacgacgatgaaggattcatgccaggtcttttcgacaaggactcc
ttcgttgagactctcggtggatgggcaaagactgttgttgttggtcgtgctcgtcttggt
ggtatcccaatgggtgtcatcgctgtcgagacccgctcagttgagaacatcacacctgcc
gatccagcaaacccagattcgaccgaacaaatttccaacgaagctggtggtgtctggtat
cctaactccgctttcaagaccgctcaagctatcaaggacttcaacaatggtgagcaattg
ccattgatgatcttggctaactggagaggtttctctggtggtcaacgtgatatgtataac
gaagttctcaagtatggaagttacatcgttgatgctttggttaaatacgagcaaccaatc
tttgtctacatcccaccattcggtgagcttagaggtggttcttgggtcgtcgttgatcct
acaatcaacccagaattcatggagatgtacgccgatgaagattctcgcggtggtgttttg
gaaccagaaggtattgtcaacatcaagtaccgtaaggacaagcaattggagaccatggcc
cgtctcgacccagagtacgctgagctcaagaaacaattactcgacaatgctgctggacag
gagaagttggctgaaatcaaggttaaggttgagcaaagagagaaggcattacttcctgtc
tacaatcaaatctcgcttcaattcgctgatcttcacgaccgtgctggacgtatgaaggca
aagggtgttatcagagagtcattgaaatggagagaggctagaagattcttctactggcgt
gtacgaagacgtgttaacgaggagtacatcctcaagcgcatgttatccgccaactcgaaa
tcaccaactggtaccagaccagagaacttgagaaaacttgccgcttggactgcaattcca
gcattccaaactgatgataagagtgtagccatgtggtatgaggagaacagaaaggttgtt
cacgagaaggttgaacaaatgaagatcgagggtgtagctgctgaggtttcggctttgctc
agagccagcggacctagtgctaagggagggttaagtggtggtgctatggctggtatcaga
caggttttgtctatgttgccagttgaggaaagagaagaggcattgaagttcttgggaaga
ccttaa

DBGET integrated database retrieval system