KEGG   Botrytis cinerea: BC1G_11314Help
Entry
BC1G_11314        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfu  Botrytis cinerea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1G_11314
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1G_11314
  Amino acid metabolism
   00310 Lysine degradation
    BC1G_11314
Enzymes [BR:bfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BC1G_11314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 370 aa AA seqDB search
MLTRRVLTASRFLLAQRSAAPQLRYPLPVIQQFRSYADKVVKVPEMAESISEGTLKQWSK
QIGDFVEQDEEIATIETDKIDVAVNAPEAGTIKEFLANEEDTVTVGQDLVRLELGGAPEG
GDKEKASSEPKEAASKDQSTSSDPEPSKKEDSKPKEDSSSPPPTEKKSEPKETPKPKPSE
SKKQESSSSSSKPSLGNREERRVKMNRMRLRIAELNASIEGPNGGDTIVYRDYVDISVAV
ATEKGLVTPVVRNTESMDLVGIEKTIADLGKKARDNKLTIEDMAGGTFTISNGGVFGSLM
GTPIINLPQTAVLGLHAIKDKPVVVNGQIVIRPMMYLALTYDHRLLDGREAVQFLVKVKE
YIEDPRRMLL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccaggagggttttaacagcctcgcgatttttgctggctcagcgttccgccgca
ccacaattgagatatccactcccagttattcagcaatttcgcagttatgccgacaaagtt
gtcaaagtaccagagatggctgaatccatctctgagggtactttaaagcagtggtcgaaa
cagatcggtgattttgttgagcaggatgaggaaattgctacaattgagacagataaaatc
gatgttgctgtcaatgctcccgaagctggcacaataaaagaattcttggccaatgaagaa
gatactgttaccgttggtcaagatttggtccgtctcgaacttgggggtgctccagaggga
ggtgataaagaaaaggcctcttcggaaccaaaagaggcagcatcaaaagatcaatcgaca
tcttcggatcctgagccatctaagaaagaggattcgaaacccaaggaggattctagctct
cctccacctacggaaaaaaaatcggaaccaaaggagacaccaaagcccaaaccatcggaa
tctaagaagcaggaatcatcatctagtagttccaaaccttctttgggcaaccgagaggag
cgtcgtgtcaagatgaaccgaatgcgactacgtattgctgagctaaacgcatccattgag
ggtcctaacgggggtgacaccattgtctacagagattatgttgatatcagcgtcgccgtc
gccactgagaaaggcttggtaactcccgttgttcgcaacactgagagcatggaccttgtt
ggtattgagaagactattgctgatctaggcaagaaggctcgtgacaacaaacttacgatc
gaagatatggccggtggaacctttactattagcaatggcggtgtgtttggttcattgatg
ggtacacccatcatcaaccttccacaaaccgctgttttgggtctacatgctatcaaagac
aagcccgttgtcgtcaatggccaaattgttattcgtccaatgatgtatctggccttgacc
tatgatcatcgtctacttgatggaagagaggctgtccagtttctggtcaaggttaaggag
tacatagaggatccaagaagaatgcttttgtag

DBGET integrated database retrieval system