KEGG   Botryotinia fuckeliana: BC1G_11314Help
Entry
BC1G_11314        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfu  Botryotinia fuckeliana
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bfu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bfu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bfu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 370 aa AA seqDB search
MLTRRVLTASRFLLAQRSAAPQLRYPLPVIQQFRSYADKVVKVPEMAESISEGTLKQWSK
QIGDFVEQDEEIATIETDKIDVAVNAPEAGTIKEFLANEEDTVTVGQDLVRLELGGAPEG
GDKEKASSEPKEAASKDQSTSSDPEPSKKEDSKPKEDSSSPPPTEKKSEPKETPKPKPSE
SKKQESSSSSSKPSLGNREERRVKMNRMRLRIAELNASIEGPNGGDTIVYRDYVDISVAV
ATEKGLVTPVVRNTESMDLVGIEKTIADLGKKARDNKLTIEDMAGGTFTISNGGVFGSLM
GTPIINLPQTAVLGLHAIKDKPVVVNGQIVIRPMMYLALTYDHRLLDGREAVQFLVKVKE
YIEDPRRMLL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccaggagggttttaacagcctcgcgatttttgctggctcagcgttccgccgca
ccacaattgagatatccactcccagttattcagcaatttcgcagttatgccgacaaagtt
gtcaaagtaccagagatggctgaatccatctctgagggtactttaaagcagtggtcgaaa
cagatcggtgattttgttgagcaggatgaggaaattgctacaattgagacagataaaatc
gatgttgctgtcaatgctcccgaagctggcacaataaaagaattcttggccaatgaagaa
gatactgttaccgttggtcaagatttggtccgtctcgaacttgggggtgctccagaggga
ggtgataaagaaaaggcctcttcggaaccaaaagaggcagcatcaaaagatcaatcgaca
tcttcggatcctgagccatctaagaaagaggattcgaaacccaaggaggattctagctct
cctccacctacggaaaaaaaatcggaaccaaaggagacaccaaagcccaaaccatcggaa
tctaagaagcaggaatcatcatctagtagttccaaaccttctttgggcaaccgagaggag
cgtcgtgtcaagatgaaccgaatgcgactacgtattgctgagctaaacgcatccattgag
ggtcctaacgggggtgacaccattgtctacagagattatgttgatatcagcgtcgccgtc
gccactgagaaaggcttggtaactcccgttgttcgcaacactgagagcatggaccttgtt
ggtattgagaagactattgctgatctaggcaagaaggctcgtgacaacaaacttacgatc
gaagatatggccggtggaacctttactattagcaatggcggtgtgtttggttcattgatg
ggtacacccatcatcaaccttccacaaaccgctgttttgggtctacatgctatcaaagac
aagcccgttgtcgtcaatggccaaattgttattcgtccaatgatgtatctggccttgacc
tatgatcatcgtctacttgatggaagagaggctgtccagtttctggtcaaggttaaggag
tacatagaggatccaagaagaatgcttttgtag

DBGET integrated database retrieval system