KEGG   Botrytis cinerea: BC1G_11317Help
Entry
BC1G_11317        CDS       T01072                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
bfu  Botrytis cinerea
Brite
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BC1G_11317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 140 aa AA seqDB search
MPPKGVASKAPAAAKAPASASKAPASKQDAGKKTTTSEGKPRKKKGRKETYSSYIYKVLK
QVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSTK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagggagttgcaagcaaggcaccagctgccgccaaggcacctgcatccgca
tcaaaggccccagctagtaagcaagatgctggcaagaagaccaccaccagcgaaggaaag
ccacgcaagaagaagggacgcaaggagacctactcttcatacatctacaaagttctcaag
caagtccacccagatactggtatctccaaccgcgccatgtccatcttgaactcctttgtc
aacgatatctttgagcgcgtcgccactgaggcatccaagctcgctgcttacaacaagaag
agcaccatctcatcaagagaaatccaaacctctgttcgtctcattctccctggtgaactc
gccaagcacgccgtctctgagggtaccaaggctgttaccaagtactcttcatccacgaaa
taa

DBGET integrated database retrieval system