KEGG   Botryotinia fuckeliana: BC1G_11409Help
Entry
BC1G_11409        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bfu  Botryotinia fuckeliana
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bfu00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bfu00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 905 aa AA seqDB search
MAELEEIPGPPGLPFLGNVSEVDPVNSIASLERLAEIYGPIFKLNLGGVEKLFISTQALL
NEICDEKRFTKVVAGSLEQVRNGVGDGLFTARHGEKNWEMAHRILMPAFGPLSIRSMFDE
MHDIASQLVMKWARFGSREKIDVTDGFTRLTLDSIAFTAKELLAERRANPNDKKDLLNAM
INGRDPKTGKGLPDSNILNNMITFLIAGHETTSGMLSFLFYYLLKNPSAYQAVQREVDEV
VGKGPITIDHMSKLPYIEACLRETLRLTPTAPAFTVFPLPDSTESPIIIGGKYEVKPGQP
ILALIPAVHRDPTVYGDDVASFKPERMLDEQFKNLPPNAWKPFGNGMRGCIGRPFAWQES
ILIVAMLLQNLNFRMDDPSYNLVIKQTLTIKPNGFFMHASLRDGIDPIHLEKMLHVDVSK
ERLSESDQKLTKVLSNPGKPKQPMSIFYGSNSGTCEALARSLAREASGRGYEAQVDPLDA
AVDKIPKDQPVILISSSYEGQPPDNASHFVEWLENLQGSDRLKGVKYAVYGCGNHDWVST
FHRIPKLLDNQFEKHGATRIGDTGLGDVADGDIFEAFDEWQDNHLWTKLTSSADHGEIGL
EIEIDSTSRSSRLRQDNVAKIASSTPEPEVREKIEYLAKEGFDTEILLKRRSPLDILEEY
PSAALSLGDFLAMLPPMRIRQYSISSSPLEDPSVATLTWSVLDTVSKAGESKRHLGVASN
YLSSVEEGDRVHVSVKPSRGAFHPPTDLENTPVIYICAGTGLAPFRGFVQERALQIAAGR
KLAPAYLFIGCGYPDKDALFSDELKKWEADGAVKLYYAFSKAPELSKGCRHVQDRLWEER
EELKKVFDSGAKLYVCGSSMVGEGVSVMTKKIYAEAADLLGKTKTDEEVEIWFQGIKNDS
EGVEI
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttggaagagatacctggacctcccggtcttcctttcttagggaacgtttca
gaagtagaccccgtcaattcgattgctagtcttgagcgtctggcagaaatatatggcccc
atcttcaaacttaacctcggaggtgtcgaaaaattattcatatctacacaagctctcctc
aatgagatctgcgacgagaagaggtttacaaaggtagtggctggaagtttagaacaagtt
cgcaatggtgttggtgatggtctcttcactgcaaggcatggagaaaaaaattgggagatg
gctcatcgaattttgatgccagcattcggtcccctatctattcgatcaatgtttgacgaa
atgcatgacattgcttcacaattagtgatgaaatgggccagatttgggtcaagggagaag
attgatgttaccgatggctttactagattgacgcttgactcaattgcctttactgccaaa
gaacttttggccgaaagaagagcaaatccaaacgataaaaaagatctactgaatgctatg
attaacggcagagatccaaaaactggcaaaggtctccccgattcgaacattttgaacaac
atgatcacctttctcattgccggtcatgaaaccacgagtggcatgctctcattccttttt
tattatttgttgaaaaatccttcagcataccaggcagttcagcgtgaagtcgatgaagta
gtcggcaagggccccatcacgattgatcacatgtcaaaactcccatatattgaggcttgt
cttcgagagacattgagattgactcccacagcacccgcttttacggtctttcctttacct
gattcaactgagtcgccaatcatcatcggcggtaaatacgaagttaagccagggcaacct
attcttgctctcattcctgctgttcaccgggaccctactgtctacggtgatgatgttgcc
tcattcaaacctgagcgaatgcttgacgagcaattcaaaaatttaccacctaacgcctgg
aaaccttttggtaatggtatgagagggtgcatcggaagacctttcgcctggcaagagtca
attctcattgtcgctatgctcttgcaaaacctcaatttcaggatggatgatccaagttac
aaccttgttatcaaacagactttgactatcaagccaaacggatttttcatgcatgccagt
ttgcgagatggcattgaccctattcacctcgagaaaatgctgcatgttgatgtttccaag
gaacgtctgtcagaaagcgatcaaaaacttaccaaggtcttgagcaatcctggaaaacca
aaacaaccaatgtctatcttctatggttcaaactctggaacatgtgaagctcttgctcgg
agtcttgcaagagaagctagtggacgtggttacgaggcccaggtagatcctcttgatgct
gctgtagacaagatccccaaggatcagccagtgattttgatatcttctagttatgaagga
caacctcccgataatgccagtcattttgttgagtggttggagaacttacaaggcagtgat
cgtctcaagggagtcaaatatgccgtatacggatgcggaaatcatgattgggtatcgacc
ttccaccgaattcctaaattactcgacaaccaatttgagaaacatggtgccactagaatc
ggagatactggactaggcgatgttgctgatggagacatttttgaggcgtttgatgagtgg
caagacaatcatctatggaccaaattaaccagcagcgcggaccacggagaaatagggttg
gaaattgaaatcgattctacctcccgctcttcgagacttcgacaagacaacgtggcaaaa
atagcctcgagtacacccgagccagaagtaagagaaaaaatcgaatatctagccaaggaa
ggctttgacacggagatcttactcaaaagacgatcgccactcgatatacttgaagaatac
ccatccgctgcattatctcttggagatttcttagctatgcttccacccatgagaattcgc
caatactcaatatcctcatcaccacttgaggaccctagtgttgcaaccttgacttggtct
gttcttgacaccgtctcgaaagccggcgaatcaaaacgtcatttgggagtggcatcgaat
tatctttcttctgttgaggagggagatcgtgtacatgtttctgtcaagccaagtcgtgga
gctttccatcctcctactgacttggaaaatactccagtgatctatatttgcgcgggaact
gggttagctcctttccgtggtttcgtacaagaacgagccttgcaaatagctgccggacga
aaattagcccctgcatacttattcattggctgtgggtatcctgacaaagatgctctgttc
tccgatgaattgaagaaatgggaggcggatggagcagtgaaactctactacgcgttctca
aaggctccagaattaagcaaagggtgtcgtcatgttcaggatagactctgggaagagaga
gaagaactaaagaaggtgttcgatagtggcgcaaagttgtatgtctgcggttcgagtatg
gttggagaaggtgtctcggtcatgactaagaagatttacgcggaggctgcggatctactt
ggaaagactaagacggatgaggaggtcgagatttggtttcagggcatcaagaatgatagc
gaaggagttgaaatttga

DBGET integrated database retrieval system