KEGG   Botrytis cinerea: BC1G_11483Help
Entry
BC1G_11483        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
bfu  Botrytis cinerea
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BC1G_11483
   03420 Nucleotide excision repair
    BC1G_11483
   03430 Mismatch repair
    BC1G_11483
   03440 Homologous recombination
    BC1G_11483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 289 aa AA seqDB search
MSNNYGYQNNYSTTSYGAQGGADGGGFVQGGYGGSQGGSQESPGGSKTYGKDTLRPVTIK
QILEAVQPHPDADFKIDGSEVTQLSFVGQVHSISTQATNNTYKVDDGTGLIEVKQWIDND
ASPENARPVPEEGKYIHVWGRLKSFHDKRHVGAHIIRPVLDMNEVTFHGLEATLAHLYFT
RGPVDTAGTMAKKEGGDGMFVDSYGGNMGAGDASTGGGKILPAKVSRNSRMVFDLLQSEP
QNNEGLNVNMIATKLGMPVADVYKCGDELLAEGCIYTTVDDETWAVLEY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaactacggatatcaaaataattattcaaccaccagttacggcgcacaaggc
ggggcagatggcggtggatttgttcaaggaggatatggtggatcgcagggaggaagccaa
gaaagtcctggaggttcaaagacatatggtaaagatacattacgaccagtaaccatcaag
caaattctcgaggccgtgcaaccacatcctgatgcagatttcaaaattgatggatcggaa
gtcactcagctctcatttgtcggccaagtccactctatctccacccaagccacaaacaat
acctacaaagtcgacgacggcaccggtctcatcgaggtaaaacagtggattgacaatgac
gcttctcccgaaaacgcaaggcctgtgccagaagaaggaaaatacatacacgtatgggga
cgactcaagtctttccatgataaacgtcatgtgggcgctcatattatccggcccgttctc
gacatgaacgaagtgacattccatggattagaagctaccctggcacatttatatttcact
cgcggtcctgtcgatacagcgggtactatggcaaagaaagagggaggcgatggaatgttt
gttgattcgtatggtggcaacatgggagctggagatgcgtctacaggtggtggtaaaata
ttacccgcgaaggtatctcgcaattcgagaatggttttcgatttattacaatcagagcct
caaaacaacgagggtttgaatgtcaatatgattgcgaccaagcttggtatgcccgttgca
gatgtctacaagtgcggagatgagttgttggcggagggttgtatttataccacggttgac
gatgagacatgggctgtgttggagtactag

DBGET integrated database retrieval system