KEGG   Botryotinia fuckeliana: BC1G_11713Help
Entry
BC1G_11713        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
bfu  Botryotinia fuckeliana
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:bfu04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 494 aa AA seqDB search
MSSPAPLLRPPIPGSRQNGGARTPRLGLAIPPSPNAKPVNAPATKGLTLQMPGSMPARPA
LPRLQLATPMGSNATPYEQSGRGAVAPGQSASGGSESSAAHSRSGSFGPMDGKGSGPTSA
GSQYSAFSLASQYGLSKPQGTPDPSSAVGSLYSERSEGGVGMERDGSMNGLEAFDKLSLE
KGRTLDVEDLDDDGWRIASMEKRIEELGSLGEGAGGAVTRCMLKGGKTVFALKIITTNPD
PDVKKQIVRELGFNKGCANEHICRYYGAFVEPSTATISIAMEFCEGGSLDSIYREVKKLG
GRTGEKVLGKVAEGVLNGLTYLHGKKIIHRDIKPSNILLCRDGQVKLCDFGVSGEFGTKG
DANTFIGTSYYMAPERITGQSYTITSDVWSTGVTLLEVAQHRFPFPADGSEMQPRAGLID
LLTYIVRQPIPKLKDEPDAGIKWSDSFKYFIECCLEKDPTRRASPWRMLEHPWMVEMRGK
RVNMAHFLATVWGW
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccagctccattattacgccctccaattccaggcagtcgacaaaatggcggc
gcaaggacacctagattgggcctggccataccaccttctcccaatgcgaagcccgtcaat
gctcctgcaaccaaaggtctcacacttcaaatgcctggctcgatgcctgcgcgaccggcg
ttacctcgattacaactagctacgcctatgggaagtaatgctacaccatatgaacaatct
ggaaggggtgcagttgcaccaggacaatctgcaagtggaggaagcgaaagtagtgctgcc
cattcaagatcaggtagctttgggccgatggacgggaagggaagtggtccaacatctgca
ggttcccagtattctgcattctcattagcatcgcaatatggtttgagcaagccgcaaggc
acacctgacccgtcatcagctgtaggctcattatactcggaaaggagcgaaggaggcgtt
ggcatggagcgggatggtagcatgaatggacttgaagcgttcgacaagctcagcttagaa
aaaggcagaacattagatgtcgaagatttagatgatgatgggtggcggatagcaagtatg
gagaaacggattgaggaactcgggagcttgggagagggagcaggaggtgcagtaactcga
tgcatgctgaagggtggaaagaccgtcttcgcattaaagataattaccacaaatcccgat
cctgacgtcaagaagcaaatcgtccgtgaattaggtttcaacaagggttgcgctaacgaa
cacatctgtcgctattacggagctttcgtagaaccatcgacggctaccatttccattgct
atggaattttgcgaaggtggttccctcgattcaatctatcgtgaagtaaagaaacttggc
ggtcgcactggtgagaaggtcctcggaaaggttgccgaaggtgtcctgaacggtctgacc
taccttcatgggaagaagatcattcaccgagatatcaaaccttccaatattctcctgtgt
cgcgatggtcaagtaaaactgtgtgattttggtgtaagtggtgagttcggtacaaagggt
gacgcaaatacctttattggcacatcttactacatggcgcctgaacgtattactggtcaa
tcatacaccatcacttccgatgtctggtcaactggtgtgacactgttggaagtcgcccaa
catcgcttcccattcccagcagatgggtcggagatgcaacctcgtgctggattgattgac
cttctaacatacattgttcgacaaccaattccaaaattgaaggacgaacccgatgctggc
atcaaatggagtgacagtttcaaatactttatcgagtgttgtctcgagaaagaccctact
cgtcgtgcctcaccttggcgaatgttagaacatccatggatggtcgagatgcgaggcaaa
cgtgtgaatatggcacacttcttagctaccgtatggggctggtga

DBGET integrated database retrieval system