KEGG   Botrytis cinerea: BC1G_11838Help
Entry
BC1G_11838        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bfu  Botrytis cinerea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC1G_11838
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_11838
  Lipid metabolism
   00071 Fatty acid degradation
    BC1G_11838
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1G_11838
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1G_11838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 367 aa AA seqDB search
MAAATAQSFDIPKQYKAIVYDKPGTISTKVEQLNTPEPGPGDVLVRLTHSGVCHSDMGIC
ENSWRGLPYPTQAGQVGGHEGVGVVHKLGPGSENGRVKVGDRVGIKWIAYACGGCLPCLE
GKDGVCFNQKISGYYYPGTFQQYALAPANYVTPIPDALDSKDAAPLLCAGVTTYSALRKS
DAKSGQWVVIAGAGGGLGHLACQIGSRGMAMRIIGIDQGSKEELVKECGAEVFIDLTKFD
DKAIAEEVKRVTGGIGASAVIVCTASNRAYSQALSFLRFGGTLVCVGMPEGDSQPIANSF
PAAMVAQEWKIKGSAVGNQREALEVLEMAARGIIKTRIRMEKMENLTEVFKEMSEGRMQG
RVVLDLS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcaacggcccaatcctttgatattcccaaacaatataaagctattgtttac
gataaaccgggaaccatttccacaaaagtcgagcaattaaacacacctgaacctggaccc
ggcgatgtgctcgtgagacttacccatagtggtgtttgccacagtgatatgggaatctgt
gaaaatagttggcgtggtcttccttatccaacgcaagctgggcaagttggcggccacgaa
ggcgttggcgtcgtccacaaactaggcccgggctcggagaatggtcgagtgaaggttggt
gatcgtgttggaattaagtggatcgcctatgcttgtggtggttgtcttccatgtcttgag
ggtaaagatggagtttgcttcaatcaaaaaatctctggctattattacccggggacattt
caacaatatgcgctcgcgccagcgaactatgtaacaccaattccagatgctctggattct
aaggacgctgctcctctactatgtgctggagtcacgacatattcagccttgagaaagagt
gatgctaagagtggacaatgggttgttatcgccggtgcgggcggtggtcttggccacttg
gcttgtcaaatcggaagtcgtggtatggcaatgagaatcattggaattgatcagggaagt
aaggaagagttggtgaaagaatgcggagcagaagtcttcatagatctcaccaaatttgac
gataaagcaattgcagaggaagtcaaaagagttactggtggtatcggagcatctgctgtc
attgtgtgcactgcttctaatcgcgcttattctcaagcgcttagctttttgagatttgga
ggaacgttggtctgcgttggaatgccggaaggcgattcccaacctatagccaactcattc
cctgcagctatggtcgcccaagaatggaaaatcaagggttcggcagtaggtaaccaacgt
gaagcattggaggtacttgagatggcggcccggggaattattaagactcgtattcgaatg
gagaagatggagaacttgacggaagtgttcaaggagatgtcggagggtagaatgcaagga
agagttgtacttgatctgtcatag

DBGET integrated database retrieval system