KEGG   Botryotinia fuckeliana: BC1G_11866Help
Entry
BC1G_11866        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bfu  Botryotinia fuckeliana
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:bfu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 744 aa AA seqDB search
MAPSFDHLPDPEEDEYDEEELDISDLRERFEVQLEQGLDTFVVIDGLPEVNEDTKPKLIK
FLLRKLDSVGQTKKDSIHMPIGPDGKSHKFAFVEYSSPVEAIAACKALDGVPLDKKHTLR
VNKLTDIDRYGREGRIDENYTPPKIEEFTEKEHLRSWLADPAGRGRDQFVMYKDDRVQVL
WNNEKDAPESIVDRQHWTESFVQWSPQGTFLTSMHQQGVQLWGGPSWTRQKRFAHPFVNL
VDFSPGEKYLTTWSNRPITIGEEGHPALSIDDDGKNYVIWDIETGLPLRSFANLDLPSNS
VDADGNPIKRKIQWPAFKWSSDDKYVARLTQGSSISVYELPKMNLLDKTSIKIDGVMDFD
WAPATPHREGVKTYEQLFCYWTPEIGSNPAKVGLMSIPSKEVVRTLNLFSVTDAKLHWQS
DASYLCVKVDRHSKSKKSLATSLEIFRVKEKGVPVEVVDSIKDTVINFAWEPKGDRFVII
TTAEVVAATAVPPKTSVSFYCPEKVKGNGVGNFKHIRTYDKKNSNAIYWSPKGRFVIVAT
VHSQQSFDMEFYDMDFEGEKPESDKDLTANLQLMNTADHYGVTDIDWDPTGRFVATSASI
WKHTMENGYHLYDFKGEQLREEPVEKFKQWLWRPRPPTLLSKEEQKQIRKNLREYSKVFD
QEDADRGASADLAVVEHRRRLLDEWLAWRANMEEDVKADREDAGLPLDPLEPLKSKMASG
DEGQAIEIEEIVEEIVEETEEIIS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaagtttcgatcatctccctgatccagaagaggacgagtacgatgaggaagag
ctcgacatttccgatctaagagaacgtttcgaagtacagctcgagcaaggactcgatact
ttcgttgttatcgatggcctcccagaggtcaacgaagatactaagcccaagttgatcaag
ttcttgttaagaaaattagactctgttggtcaaacaaaaaaggactcaatacacatgccc
atcggaccagatggcaagtcgcacaaatttgctttcgtcgaatactcctcccctgttgaa
gctattgctgcatgcaaagccctcgatggcgtgcccctcgacaagaaacacacccttcga
gtcaacaaattgacggatattgatcgctatggtcgggaaggacgtattgacgagaactac
acccctccaaaaatcgaagagtttaccgagaaggagcacttgagatcatggcttgcggat
ccagccggacgtggacgggatcaatttgtcatgtataaggatgacagagtacaagttctc
tggaacaacgagaaggatgcaccagaaagtatcgtcgatcgccaacactggactgaatca
tttgtacaatggtcaccccaaggtactttcttgacctcgatgcatcaacaaggtgtacaa
ctctggggtggaccatcttggactagacaaaagcgtttcgcgcatcctttcgtcaacctg
gtcgacttttcgccaggagagaaatacctcacaacatggtcgaatagaccaatcaccatc
ggagaggaaggtcacccagctttatctattgatgatgatggaaagaactatgttatctgg
gatattgagactggcttgccattacgttctttcgccaacctcgatttaccaagcaacagc
gttgatgcagacggtaaccctatcaagagaaagatacaatggccagcgttcaagtggtca
tcagatgacaaatacgttgcgcgtttgactcaaggctcatcgatttctgtttatgagtta
cctaaaatgaaccttctagacaaaacctcgataaaaattgacggtgtaatggacttcgac
tgggcaccagcaaccccacaccgtgagggtgtcaagacctacgagcaattgttctgctac
tggactccagaaattggtagcaacccagctaaggttggattgatgagcattccatctaaa
gaagttgtccgaacattgaacctcttcagtgtgaccgatgcaaagctccactggcaatca
gacgcatcatatttgtgtgtcaaggttgatagacattcaaagtctaagaaatctctcgca
accagtttggaaatcttccgcgttaaagaaaagggagtccccgttgaggttgttgattcg
atcaaagacaccgttattaattttgcttgggagcccaagggtgaccgctttgttatcatc
acaaccgcagaagtcgttgcagccacagccgtcccacctaagacatccgtatccttctac
tgcccagagaaggtcaagggcaatggtgttggtaacttcaagcacatccgcacatatgac
aaaaagaacagcaacgctatttactggtctccaaagggtagattcgttattgtagccaca
gtccactcgcaacaaagtttcgatatggaattctatgacatggactttgagggcgagaaa
cccgaaagtgacaaggacttgacagctaatctacagcttatgaataccgcagatcattat
ggtgtaacagacatcgactgggatcccacaggacgtttcgttgctaccagtgccagtatt
tggaagcacaccatggagaacggctaccatttgtacgacttcaagggtgagcaacttcgt
gaagagccagtcgagaagttcaagcaatggttgtggcgtcctcgaccacccactctactt
tctaaggaggaacaaaagcaaatccgcaaaaatctccgtgaatacagcaaagtattcgat
caagaagatgccgaccgtggtgcatccgccgatcttgctgttgttgagcatagacgtaga
ctcttggacgaatggcttgcatggagagcaaatatggaggaggatgtcaaggctgacaga
gaagacgcaggtcttcctcttgaccctctggagcctctcaaatctaagatggcaagcggt
gatgaaggacaagctattgagattgaagaaattgttgaggagattgttgaagagactgaa
gagattatatcatga

DBGET integrated database retrieval system