KEGG   Botrytis cinerea: BC1G_11866Help
Entry
BC1G_11866        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bfu  Botrytis cinerea
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BC1G_11866
Translation factors [BR:bfu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    BC1G_11866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 744 aa AA seqDB search
MAPSFDHLPDPEEDEYDEEELDISDLRERFEVQLEQGLDTFVVIDGLPEVNEDTKPKLIK
FLLRKLDSVGQTKKDSIHMPIGPDGKSHKFAFVEYSSPVEAIAACKALDGVPLDKKHTLR
VNKLTDIDRYGREGRIDENYTPPKIEEFTEKEHLRSWLADPAGRGRDQFVMYKDDRVQVL
WNNEKDAPESIVDRQHWTESFVQWSPQGTFLTSMHQQGVQLWGGPSWTRQKRFAHPFVNL
VDFSPGEKYLTTWSNRPITIGEEGHPALSIDDDGKNYVIWDIETGLPLRSFANLDLPSNS
VDADGNPIKRKIQWPAFKWSSDDKYVARLTQGSSISVYELPKMNLLDKTSIKIDGVMDFD
WAPATPHREGVKTYEQLFCYWTPEIGSNPAKVGLMSIPSKEVVRTLNLFSVTDAKLHWQS
DASYLCVKVDRHSKSKKSLATSLEIFRVKEKGVPVEVVDSIKDTVINFAWEPKGDRFVII
TTAEVVAATAVPPKTSVSFYCPEKVKGNGVGNFKHIRTYDKKNSNAIYWSPKGRFVIVAT
VHSQQSFDMEFYDMDFEGEKPESDKDLTANLQLMNTADHYGVTDIDWDPTGRFVATSASI
WKHTMENGYHLYDFKGEQLREEPVEKFKQWLWRPRPPTLLSKEEQKQIRKNLREYSKVFD
QEDADRGASADLAVVEHRRRLLDEWLAWRANMEEDVKADREDAGLPLDPLEPLKSKMASG
DEGQAIEIEEIVEEIVEETEEIIS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaagtttcgatcatctccctgatccagaagaggacgagtacgatgaggaagag
ctcgacatttccgatctaagagaacgtttcgaagtacagctcgagcaaggactcgatact
ttcgttgttatcgatggcctcccagaggtcaacgaagatactaagcccaagttgatcaag
ttcttgttaagaaaattagactctgttggtcaaacaaaaaaggactcaatacacatgccc
atcggaccagatggcaagtcgcacaaatttgctttcgtcgaatactcctcccctgttgaa
gctattgctgcatgcaaagccctcgatggcgtgcccctcgacaagaaacacacccttcga
gtcaacaaattgacggatattgatcgctatggtcgggaaggacgtattgacgagaactac
acccctccaaaaatcgaagagtttaccgagaaggagcacttgagatcatggcttgcggat
ccagccggacgtggacgggatcaatttgtcatgtataaggatgacagagtacaagttctc
tggaacaacgagaaggatgcaccagaaagtatcgtcgatcgccaacactggactgaatca
tttgtacaatggtcaccccaaggtactttcttgacctcgatgcatcaacaaggtgtacaa
ctctggggtggaccatcttggactagacaaaagcgtttcgcgcatcctttcgtcaacctg
gtcgacttttcgccaggagagaaatacctcacaacatggtcgaatagaccaatcaccatc
ggagaggaaggtcacccagctttatctattgatgatgatggaaagaactatgttatctgg
gatattgagactggcttgccattacgttctttcgccaacctcgatttaccaagcaacagc
gttgatgcagacggtaaccctatcaagagaaagatacaatggccagcgttcaagtggtca
tcagatgacaaatacgttgcgcgtttgactcaaggctcatcgatttctgtttatgagtta
cctaaaatgaaccttctagacaaaacctcgataaaaattgacggtgtaatggacttcgac
tgggcaccagcaaccccacaccgtgagggtgtcaagacctacgagcaattgttctgctac
tggactccagaaattggtagcaacccagctaaggttggattgatgagcattccatctaaa
gaagttgtccgaacattgaacctcttcagtgtgaccgatgcaaagctccactggcaatca
gacgcatcatatttgtgtgtcaaggttgatagacattcaaagtctaagaaatctctcgca
accagtttggaaatcttccgcgttaaagaaaagggagtccccgttgaggttgttgattcg
atcaaagacaccgttattaattttgcttgggagcccaagggtgaccgctttgttatcatc
acaaccgcagaagtcgttgcagccacagccgtcccacctaagacatccgtatccttctac
tgcccagagaaggtcaagggcaatggtgttggtaacttcaagcacatccgcacatatgac
aaaaagaacagcaacgctatttactggtctccaaagggtagattcgttattgtagccaca
gtccactcgcaacaaagtttcgatatggaattctatgacatggactttgagggcgagaaa
cccgaaagtgacaaggacttgacagctaatctacagcttatgaataccgcagatcattat
ggtgtaacagacatcgactgggatcccacaggacgtttcgttgctaccagtgccagtatt
tggaagcacaccatggagaacggctaccatttgtacgacttcaagggtgagcaacttcgt
gaagagccagtcgagaagttcaagcaatggttgtggcgtcctcgaccacccactctactt
tctaaggaggaacaaaagcaaatccgcaaaaatctccgtgaatacagcaaagtattcgat
caagaagatgccgaccgtggtgcatccgccgatcttgctgttgttgagcatagacgtaga
ctcttggacgaatggcttgcatggagagcaaatatggaggaggatgtcaaggctgacaga
gaagacgcaggtcttcctcttgaccctctggagcctctcaaatctaagatggcaagcggt
gatgaaggacaagctattgagattgaagaaattgttgaggagattgttgaagagactgaa
gagattatatcatga

DBGET integrated database retrieval system