KEGG   Botrytis cinerea: BC1G_11880Help
Entry
BC1G_11880        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
bfu  Botrytis cinerea
Brite
Protein kinases [BR:bfu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   BC1G_11880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2372 aa AA seqDB search
MSQQSNQAFDALNRIVADLRSRSDEQRKRAALELRELLEVASRDFPQERYTEFSNIVSGK
ITSLIGHHGDVERTGGIYAIDALVDFDGIEVGQRVTRFGQSLRNILRGKDLAPMQPAAMA
LGKMCRPGGLRDQRLLIRQTAAEAISACFQIIRERDPTLRQTWQAKIYDEAVQGVRQGTV
EYIHGSLLVIKELLQQGGMFMHEHYPEVCEIVFRHKDHRDAQIRKTVVMLIPELANYSPT
EFAQSYLHRFMVFLSGMLKKDKDRNDAFLAIGNIANAVKSAIASYLDGVLIYVREGLSLK
SRRLGTVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACELSPKLTQALVDMAFYIPPVK
PIIQERLLDMLSKVLCGEPFKPLGAPTPNNIAAAPVVPKDSKDPQAYEHRQSEIKLALNT
LGSFDFSGHVLNEFVRDVAIKYVEDENPEIREAAALTCCQLYVRDPIVNQTSHHAIQVVS
EVIEKLLTVGVGDPDPSIRRVVLAALDERFDRHLAKAENIRTLFFALNDEVFQIREVAIT
IIGRLTHVNPAYVIPSLRKVLIQMLTELEFSDVARNKEESAKLLSLLVQNSQKLIKPYVT
PMMDVLLPKARDPSPAVAATIMKAIGELACVGGEGMIPFIKQLMPIIIEALQDQSSSAKR
EASLRTLGQLASNSGYVIKPYLEYPRLLEILQNIIRGEPQRGPLRQETIKLMGILGALDP
YRHQQVEERSPEMQLRLESNQMTDISLMMTGLTPSNKEYFPTVVINALLNILKDPSLNQH
HAMVIEAIMSIFRTLGLECVSFLDKIIPAFLSVIRTSPQTRLESYFSQLSLLVTIVRQHI
RNYLPEIVLVLQEYWNESPPLQANILHLVEAISRSLEGEFKVYLASLLPLMLGVLEKDTT
TRRLPSERVLHAFLVFGPSAEEYMHLIVPVIVNVFEKPQQPSFIRKAAIETIGKISRHVN
LNDYASKIIHPLSRVLAGSDSSLRLASLDTLCALIFQLGRDYLHFAGTINKVLNSHQIQH
QNYELLVSKLQKGEPLPQDLSAEERYLNQSDEVDFSDVSNKKLDSNPVHLKAAWDATGKS
TKEDWQEWMRKFSASVLLESPNHALRSCAQLASVYPPLARELFNSAFVSCWGELFEGYQD
DLIQNIEMAIKSPHVTPDLLGILLNLAEFMEHDDKALPIDIRVLGREAGRCHAWAKALHY
KELEFCQDQTSGAVEALIQINNQLQQYDAAIGILRKAQLYKDGITLRETWFEKLERWEEA
LEFYKRREEDFPDQAETFDVIMGKMRCLHALGEWESLSALAEDKWHTSSLEIKRAIAPLA
TAAAWGLRKWDLMDDYLSVMKSHTPDRSFFGAILALHRNQFREAALFVQKAREGLDTELS
ALVSESYNRAYTVVVRVQMLAELEELSIYKQSNNNPAKQEVMRQTWETRLLGCQRNVEVW
QRMLKLRALVITPMENMQMSIKFANLCRKSGRMGLAEKHLKTLMGGDESLDVVLPQIVES
ANGDRRVRVSNKHIEAPVQYAILKFHWAVGKQSQALEALKIFTSGLAEKLQQAQIATQGG
IINDMHAMNLHNGTNGMMNGNGYANGLGANAHSLLTPKGLADHTTLLARCCLKQGEWQVA
QKKGNWQNDNLNDILASYKAATHFNPQWYKAWHAWALANFEIVQAVQTDPGHELHDVNGG
NVVVNHVVPAVRGFFKSIALSQGSSLQDTLRLLTLWFAHGGHAEVNQAVTEGFSSVSVDT
WLEVIPQLIARINQPNARVRASIHNLLADVGRAHPQALVYPLTVAMKSAPNTRRSRSAMQ
IMDSMRQHSPKLVDQADLVSKELIRVAVLWHEQWHEGLEEASRLYFGDHNIEGMFNTLAP
LHDMLDNGPETLREISFAQTFGRDLQEAREWCITYQRTKDLGDINQAWDLYYQVFRRIAR
QLPQLNNLELAYVSPKLLNAHDLELAVPGTYQSGKRIISIVNFDSNFSVISSKQRPRKLS
LKGSDGVAYVFCLKGHEDIRQDERVMQLFGLCNTLLTSDSESYKRHLNIQRYPAIPLSQN
SGLLGWVPNSDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDN
TTGQDLYRVLWLKSKSSESWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGNI
VHIDFGDCFEVAMTREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCENVMRVLRENKES
LMAVLEAFIHDPLLNWRLNGEASPVGPNFRSERRESIIAAQNRRPSTMDEFVQPAALTAD
AGDPIAAPGGPPASRPRARTNSTTQGPQDIEAHENQNTRAVQVLVRVKEKLTGHDFKPEE
ELPYIQQVDKLLIEATKLENLCQHYIGWCSFW
NT seq 7119 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaatctaatcaagcatttgatgctttgaatcgcattgtggcagatttaaga
tcacggagtgatgaacagcgaaagagagcggccctggagttaagagagttgcttgaggtt
gcttctagagactttccccaggaacgatacacggaattttccaatattgtaagtggaaag
attaccagcctcatcggtcaccatggagatgttgagcgaactggtggtatatatgctatc
gatgcgctggtcgattttgacggtatagaagtcggacaacgagtcactcgattcggacag
tcccttcgaaatatattgagggggaaggatcttgctcctatgcaaccggcagcaatggca
ttgggaaagatgtgtaggcctggaggcttgagagatcagcgactccttatccgacagact
gcagcagaagccataagtgcatgctttcagataattagagagagagatccaactttacga
cagacatggcaagcaaaaatatacgacgaagctgttcagggcgtgaggcaagggactgtg
gaatatatccatggatcccttcttgtgattaaggagcttcttcagcaaggtggtatgttt
atgcatgagcattatccagaagtctgcgaaattgtttttcgacacaaagatcaccgagac
gcacagattcggaaaacagttgttatgctgatacccgaattggcgaactattcccctacc
gagtttgctcaatcttaccttcacaggtttatggttttcttatctggaatgctcaagaag
gataaagatagaaatgacgcgttcttggctattggaaacatcgccaatgctgtcaaaagt
gctattgcttcttacctagatggagttttaatatatgtcagagaaggcttgtcattgaag
tcgagacgactcggcacagtggacccagtctttgattgcatcagtaggttggccgtcgca
gttgggcaaaccctcagcaaatatatggaggcacttttagaccccatattcgcatgtgag
ctaagtcccaagttgactcaagctttggtggatatggctttctatataccaccagtaaag
cctatcatccaagaaagattgctggacatgttgagcaaggttctctgtggcgagccattt
aaaccgctgggagcccctacaccaaacaacattgctgctgcgccagtcgtgccaaaagac
tcaaaagatccacaagcatatgagcaccgccaaagcgaaatcaaactagcccttaacact
ctagggagttttgacttttctggacatgttctaaacgaatttgtgcgtgatgttgctatc
aaatatgtcgaagatgagaatccagagattagagaggcagctgctttgacgtgctgccaa
ctttacgtccgagatcctattgtgaatcaaacgagtcaccatgcgattcaagtcgtcagc
gaagttattgagaaattacttaccgtcggtgttggagatccggatcctagcattcgaaga
gtggttttagctgctcttgacgaacgatttgatcgccatcttgctaaagcagagaacatc
cgaactctgttctttgctttgaatgacgaagtattccaaatccgtgaagttgctatcacc
atcattggtcgcttgacgcatgttaatcctgcatatgtcattccttctttgcgaaaggtt
ctcattcaaatgctcacagaactcgagttctccgacgtagcgagaaataaagaagaaagc
gctaaactgcttagcttactcgttcaaaattcacagaaattgattaaaccatatgtcaca
cctatgatggatgttttattgcccaaagctcgcgatcctagtccagctgtggctgctact
attatgaaggctatcggtgagcttgcctgtgttggaggagagggcatgattccattcatc
aagcagctcatgcctataatcatcgaagccttgcaggatcaaagctcttctgccaaacgt
gaagcttctttacgaactttaggtcaactggcaagcaactcaggctatgtcattaaaccg
tatttggaataccctcgacttttggagattttgcagaatatcattcgaggagaaccacaa
cgaggtccattgcggcaagagactatcaaacttatgggtattcttggtgctttggatcca
tatcgacatcagcaagttgaagagcgatccccagagatgcaattacgtctagagtcaaac
cagatgactgatatatctcttatgatgacagggctgacaccctccaataaggaatatttt
ccaactgttgtgataaatgctcttctcaatatcttgaaggatccatctcttaaccaacat
catgctatggttatcgaagccatcatgtcaattttcagaaccttaggactagaatgcgtc
tctttccttgataagatcattcctgcatttttgtctgtaattcgaacctctccacaaacc
cgtcttgaatcatacttcagtcagttaagtttgttggtgaccatcgtacgacagcacatc
cgtaattacttaccagagattgtcctggtacttcaagaatactggaatgaatctccgcca
ctgcaagccaacattcttcaccttgtcgaggctatctcgagatctctagaaggtgaattc
aaggtttatctggctagcctattgccactcatgctgggcgtgctcgaaaaggatactaca
acaaggcgacttccttcagagcgtgtgctgcatgctttcctggtgtttggccctagcgct
gaggagtatatgcatttgatcgtgcctgttatcgttaacgtatttgagaaacctcagcaa
ccttcgtttatccgaaaagccgcgattgaaactatcggtaagatctcaagacatgtcaac
ctgaatgattacgcctcgaaaatcatacaccccctctcaagagttttggctggtagtgat
agctcattgagattggcatcactcgataccctttgtgctctaatatttcagctcggaagg
gattatctacacttcgccggcacaatcaacaaagttctcaacagtcaccaaattcagcat
caaaactacgaactgttggtcagtaaactccaaaaaggagaacctttgccacaagatctc
agtgctgaggaacgttatttgaatcaatccgatgaagtcgatttctcggatgtttccaat
aaaaaactggatagcaatcctgtccacttgaaggctgcttgggatgcaacagggaaatcc
accaaggaggattggcaggaatggatgcgcaaatttagtgcatctgtattattggagtca
ccaaatcacgcactcagatcatgtgctcaactggcttcagtatatccaccccttgcaaga
gaactgttcaattctgctttcgtctcatgttggggagagttattcgaagggtaccaggat
gatctgatacagaatattgaaatggcgatcaaatcgcctcacgtcactcctgatcttttg
ggcatcttgctgaaccttgcagagttcatggagcacgacgataaagccttgccaatcgat
ataagagttctgggacgagaggctggtaggtgccatgcctgggccaaggctcttcactac
aaggagctggagttttgtcaagatcaaactagtggagccgttgaagcattgattcaaatt
aacaatcagctacaacagtatgatgctgcaataggtattttacgaaaagcgcaactctac
aaggatggtatcacattacgagagacttggtttgagaagctcgagagatgggaagaggct
ctcgaattttacaagaggcgcgaagaagattttccagaccaagcagagacttttgacgtt
ataatgggtaaaatgagatgtctgcacgcattgggagagtgggagtcactctcggccttg
gctgaggataaatggcatacctcgtcactcgagatcaagagagccattgctcctttggct
acagcagctgcttggggtctcagaaagtgggatcttatggacgattacctaagtgttatg
aagagtcacacaccagatcgatcattctttggcgcaattcttgcattgcatcgcaatcaa
tttcgcgaggctgctcttttcgttcaaaaggccagagagggactagacacagaattgagt
gctttggtcagcgagtcttataacagagcctacacggttgttgttcgggtacagatgctt
gcagagttggaagaactcagtatatataagcagagcaataacaacccagcgaaacaggaa
gttatgcgtcaaacttgggagactcgtttgctcggatgccaacggaatgttgaggtctgg
cagagaatgttgaagttgagagctctggtcataacccccatggaaaacatgcagatgtct
atcaaattcgcgaacctatgtaggaagtcaggacgaatgggattggccgaaaaacacctc
aaaactctgatgggcggcgatgagagcctggatgtggtattgcctcagattgtggagagt
gcaaacggagatcgacgagtcagggtttcaaataaacatattgaagctccagttcagtat
gctatattgaagttccactgggccgtgggcaaacaatcccaagcattggaagctcttaag
atatttacatctggcctggcagagaaactacaacaagcacaaatcgcaactcaagggggc
atcataaacgacatgcatgccatgaaccttcataacggtacaaatgggatgatgaacgga
aatggatacgccaatggtctcggggcaaatgctcacagcctgctaacaccaaagggtttg
gctgaccataccacactccttgctaggtgctgtctcaagcaaggagaatggcaagttgcc
cagaagaagggtaattggcaaaatgacaatcttaacgatatccttgcatcgtataaagca
gccactcacttcaatccacaatggtacaaggcatggcatgcttgggctttagcaaacttt
gaaattgtccaggcggttcagacagaccccgggcatgagttgcatgatgtcaatggtggt
aatgtcgtcgttaatcacgtcgttcctgctgttcgtggtttcttcaagtcaattgctctg
tcgcagggaagctctttgcaagataccttacgccttctcaccctttggttcgctcatggt
ggccatgcagaagtcaatcaagccgttaccgaaggcttttcttctgttagtgttgacact
tggttagaagtcattccccaacttattgcacgcatcaaccaaccaaatgctcgcgttcgc
gcttctattcataatttacttgcagatgttggtagagctcacccgcaagcactagtctat
ccattaactgtcgccatgaaatccgcccccaatacacgtcgttcacgatcagctatgcaa
attatggatagtatgcgacaacacagtccgaaattggtagaccaagcagatcttgtcagt
aaagagttgattcgtgtggcagtattatggcacgagcaatggcacgaaggtcttgaagag
gcatccagactgtactttggcgaccacaacatcgagggtatgttcaatacactcgcacct
ttacacgatatgctcgacaacggcccagagaccttgcgagaaatctccttcgctcaaaca
ttcggtcgtgatcttcaagaggctcgagaatggtgtatcacctaccaaagaacgaaagat
cttggagatatcaatcaagcttgggatctatactatcaagtcttcagaaggatcgcacgc
caattaccgcagcttaacaatcttgagttggcttatgtgtcccctaagcttctcaatgct
catgatcttgagttggctgtccccggaacgtatcaaagtggaaagcgtatcatatcaatc
gtcaatttcgatagcaactttagtgttatttcttccaagcaacgtccaagaaaactcagt
ctgaagggaagtgatggtgtcgcttatgtcttttgtcttaagggacacgaagatattcga
caggatgaacgtgtcatgcaattgtttggtctctgtaataccttactcaccagcgattcg
gagtcttataaacgtcatcttaacatacaaagatatcctgccattccactgtcccagaat
tccggtcttcttggttgggtacccaacagtgataccctacatgtcctcattcgagagtac
agagaaagtaggaagatcttgctcaacatcgaacaccgcattatgttacaaatggcccct
gattatgacaatcttacacttatgcaaaaagttgaagtctttggttatgctctcgataat
acaactggtcaagatctttatcgtgtactttggctaaagagcaagagttctgaatcctgg
cttgagaggcgcacaaactataccagatcattgggagtgatgtctatggtcggatacatt
cttggtcttggtgatcgtcatccttcgaatttgatgctcgatcgaataaccggtaacatc
gttcatattgattttggagactgtttcgaagttgccatgactcgtgaaaaataccccgaa
cgcgttccgttcaggttgacaaggatgttgacatatgctatggaagtcagcaatattgaa
ggaagctttagaattacctgcgaaaatgtgatgagagtattgagagagaacaaggagtct
ttgatggcagttcttgaggctttcatccatgaccccctccttaattggcgtttgaacggt
gaagcttcacctgtaggacctaacttccgatcagagcgccgggaatctattatcgctgcc
cagaatcgtagaccttcaacaatggacgaattcgttcaacctgcagcgttaactgcggat
gctggagatcctattgcagctccgggtggaccaccagcttcgcgtcctcgtgcaaggacg
aattccacgactcaaggccctcaggatatcgaggcacacgaaaatcagaacacgagggca
gtacaagtactggtacgcgtcaaggaaaagttgacggggcacgattttaagcctgaggag
gaattaccatatattcagcaagttgacaagttgttgattgaggcgacaaagttggaaaac
ctttgtcaacattatattggttggtgtagtttttggtaa

DBGET integrated database retrieval system