KEGG   Botrytis cinerea: BC1G_11910Help
Entry
BC1G_11910        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bfu  Botrytis cinerea
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BC1G_11910
   00500 Starch and sucrose metabolism
    BC1G_11910
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BC1G_11910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 313 aa AA seqDB search
MATFKYIPSFLLAILLFVGFIDATPLLQKRAGRTSPPSGCLTVRGSGTLSGEYSTVGAAL
TALGSSTAVACIFIYSGTYNEQVTISYAGNLTVYGYTTNIGLDASSTAKITSANFKAYNV
NFANTYGAGVQAVAVTASGDQQGYYGCSFTGYQDTLYAKSGKQYYSNCYIEGAVDYIFGN
AAAWFGECTIASNGGGAITANSRTLATDSAWYIIDSSTITQAAGYSLTGKVYLGRPWRAL
ARVIFQNSVLTDVVNAAGWTTLAADATPIFMEYANTGAGSSTSARIYETAATGTVSKTTL
WGNNWASWIDSSY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttcaaatatatcccgagtttcttacttgccattctcttatttgttggtttc
atagatgcaacacctctactgcaaaaaagagctggccgaactagtccaccctctgggtgc
ctgacagtgagagggagcggtactctctccggcgaatatagcacagttggggctgctttg
actgcccttgggtcgtcaactgccgttgcatgcatttttatatatagcggaacatacaac
gagcaagtaactattagttatgcaggaaatctcaccgtctatggatacactacaaatatt
ggcctcgatgctagctctacagcaaagatcacaagcgccaatttcaaggcttataatgtc
aactttgcaaatacctatggagccggagttcaggccgttgctgtgaccgccagtggggac
cagcaaggatactatggatgctcattcactggctaccaagatactctttatgccaaatcc
ggcaagcaatattactcgaattgttatattgaaggggctgtggactatatatttgggaat
gctgctgcttggttcggtgaatgtacaattgcttcgaacggaggaggtgcaatcaccgca
aactcaaggacacttgctactgattctgcttggtatattattgacagcagcaccattact
caagcagccggatatagtctgacaggaaaggtctacctcggaagaccatggcgagctctt
gctcgtgtaatattccagaactctgtattgacagacgtggtgaacgcagcggggtggact
acacttgccgctgatgctacaccaatatttatggaatatgccaataccggagctggctca
agcacatctgcgaggatttatgaaacggctgccaccggaactgtcagtaagaccacattg
tggggaaataattgggcttcttggattgattcttcatattaa

DBGET integrated database retrieval system