KEGG   Botrytis cinerea: BC1G_11963Help
Entry
BC1G_11963        CDS       T01072                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bfu  Botrytis cinerea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1G_11963
Enzymes [BR:bfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BC1G_11963
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1G_11963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 211 aa AA seqDB search
MMHLCDAEMYTNMSRLTEFTPIIERGMALHKMIRLLTSGLGGEGYLNFEGNEFGHPEWLD
FPREGNNNSFWYARRQFNLPDDDLLRYKALNEFDSHMQHLEEKYGWLHSDQAYISLKNES
DKVIVFERAGLLWIFNFNPTQSFVDYRVGVEQEGTYKAVLNTDTKDVGGFERIDSSTRFF
TTPFAWNDRKNFIQVYIPTRTAIVLALESTL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacttgtgtgacgcagagatgtatacaaatatgtcaagacttacagagttcacg
ccaattatcgagcgtggaatggcattacacaagatgattcgcctcctgacatccggtctt
ggaggtgaaggttatcttaatttcgagggtaacgaattcggtcatccagaatggctcgac
ttccctcgtgaaggcaataacaacagcttttggtatgcacgtcgtcaatttaaccttcca
gatgatgatcttcttcgttacaaagcattgaacgagttcgattctcatatgcaacatctt
gaagaaaagtatggatggttacacagcgatcaagcttacattagcttgaagaatgagtct
gataaggtcattgtctttgagcgagctggcttgttatggatcttcaatttcaacccaaca
caaagtttcgtagattacagagttggcgtggaacaagagggtacttacaaagctgttctc
aacactgataccaaggatgttggagggttcgaaagaatcgactcttcaacacgcttcttc
acaacaccttttgcatggaacgacagaaagaactttattcaagtatatattccaacccgt
acagcaatcgtgttggcactcgaatctacactataa

DBGET integrated database retrieval system