KEGG   Botryotinia fuckeliana: BC1G_11969Help
Entry
BC1G_11969        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 780 aa AA seqDB search
MQPNTQERLHLQQQQIQLHENVHAGSINAVLSNGNGNGFVDPRVLTTTEDMTITYDYHDP
EDEIYSSSSSSEDTKIIAMPRQAYLPSGVCYDDRMKLHTSGDYSDNTAHPEDPRRIEHIM
RAFKDAGLVYTGNAENVEKILKESPNKYMQRIMARLARKDEICLAHTAFHYDWVESLLSM
TSEELREANQRYDTGRKSLYVGPCTYDAALVAAGGAIETCKHVVVGNVKNAIAIIRPPGH
HAEENEALGFCVFNNVPIAAKVCMADYPEICRKVLILDWDIHHGNGTQNMFYDDPNVLYI
SLHVYDNGQFYPGQPDDPSLPDGGNDKVGRGAGLGKNVNIGWVSQGMGDGEYMAAFQRIV
MPIAQEFDPDLVIISAGFDAAAGDELGGCFVTPACYSHMTHMLMSLADGKVAVCLEGGYN
LAAISQSALAVAKTLMGEPPIRLPLPPLNRTAAGVFEEVKYYQSEYWQCMRSGVVDYKDP
KFRRALRLDDQIRNGQSNTLKTNYRMTSLWIQRHQLARSFDNQVMVTPYINLAKRLLIIV
HDPPTLYASPDPDTAQIALHNAFVVEPPVNDFIAWAIENKIGVMDINIPLNTDVALPATS
RYPPHPGMTELESQMKDLVCYIWDNFIQLYDSDNIMLMGVGDSYLGIKQLLTSRDCRNRL
AGILAFITGSLRPVKSETDSALSSWYKANSEIYVADKHACWNDEDSIRKVKKQRFGKVVR
SEETDLASMLQIHQSRAKKWMLAKFDEKAVDDQVMVMGDEIPVTNIDGGNMSTMMETQFV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgaatacacaggaacgtttgcatttacagcagcaacagattcaacttcatgaa
aatgtccatgcaggatctatcaacgcggtgttgtcaaacggcaatggtaatggatttgtt
gaccccagagtcctaactaccacggaagacatgactatcacttatgattatcatgaccca
gaggatgaaatatattcatcatcatcatcatcagaagatacaaagatcatagctatgcca
cgccaagcatatctcccttctggggtttgttatgacgatcgaatgaagctccacacctct
ggagactattcagataatacggcacacccagaagaccctcgacggatagaacatataatg
agagcctttaaagacgctggcttagtctatactggcaatgcggaaaatgtcgagaaaatt
ctcaaggaatcacctaacaagtatatgcagcgtatcatggcaagattagctcgaaaggac
gagatctgcctggcacatactgcatttcactatgactgggttgaatccttgttaagcatg
acttctgaagaattgcgcgaagcaaatcaaagatatgatactggtcgaaagtcactttat
gttggaccttgtacttacgacgctgcactggtcgccgcaggtggtgcgatagaaacttgc
aaacacgttgttgtggggaatgtaaaaaatgctattgccattattcgaccgcctggacat
cacgccgaagagaatgaagcgctaggattttgtgtcttcaataacgtacctatcgctgct
aaagtttgtatggcagattatcctgagatatgtagaaaggtattgattctggattgggat
attcaccatggaaacggcacccagaacatgttttatgacgatccaaacgtcttatatatc
tcacttcatgtatatgacaatggccaattttatcccggtcagcctgatgatcctagtctt
cccgacggtggtaatgataaagtcggtcgtggagccggccttggcaagaatgtcaatatc
ggatgggtctctcaaggtatgggagatggggagtacatggcagcattccaaaggatcgtt
atgcctattgcccaagagttcgatcccgaccttgtcattatttctgcaggatttgacgct
gccgcgggagacgaacttggaggatgttttgtaacaccagcctgctattctcacatgacc
catatgctcatgtctcttgctgatgggaaggtggcagtctgtctcgagggtggttataat
ttagcagcaatctcacaatctgctcttgcagtcgccaaaactttaatgggagaaccacca
attagacttcctcttccaccgttgaatagaactgctgccggagttttcgaagaagtcaaa
tactatcaatctgagtattggcaatgtatgcgatctggagtcgttgactacaaagaccca
aaatttagaagagcccttcgtcttgatgatcaaatcagaaatggacaaagtaatacattg
aagactaactatcggatgacttccttgtggattcaacggcaccaactagcaagatccttt
gataatcaagttatggttacgccatatatcaatcttgcgaagagattattgataatcgtt
catgatcctccgacattgtatgcttcccctgatccagacacagctcaaatcgccttacat
aacgcctttgttgtcgaacctccagttaatgattttatcgcctgggccattgagaataaa
atcggtgtaatggatatcaacatcccgttgaacacagacgttgctctccctgccactagt
cgttacccaccccaccctggtatgactgagcttgaaagtcaaatgaaagatcttgtttgc
tatatttgggacaattttatccaactttacgactcagacaatatcatgcttatgggcgtt
ggggactcttaccttggcattaaacagttactcacctctagagattgccgcaatcgcctt
gccgggatacttgcctttataactggtagtcttcgacctgtcaagagcgaaacggattca
gctctgagtagttggtacaaggcaaatagtgagatctacgttgctgacaagcatgcgtgt
tggaatgacgaagatagtattaggaaggttaagaaacagcgatttggaaaggtggtgcga
agtgaagagacggacttggcaagtatgttgcagatacatcagtcaagggcaaagaagtgg
atgctcgcaaagtttgacgagaaagcggtagacgaccaggttatggtgatgggggatgag
atcccggtcactaatattgacggtggtaatatgtcaacaatgatggagactcaatttgtg
taa

DBGET integrated database retrieval system