KEGG   Botryotinia fuckeliana: BC1G_12168Help
Entry
BC1G_12168        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bfu  Botryotinia fuckeliana
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bfu00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 477 aa AA seqDB search
MGDHNSVSSHESFVWHEHDPLEIIDSIEVCIECAVNQFEQQGHSARQIKAVGLTNQRETT
VVWDHETGEPLANAIVWTDTRNQALIRKLKARLGSNQLQGLCGLPLSTYPSVGKLLWLIE
NNSKVADAYARGQLAFGTIDSWVIYRLNGGPKKNVFVTDPTNASRSMFMNLHTLKYDEQL
LDFFRFDMDKLHLPKIVRSSDRESFGALTTGILKGVPITGVLGDQSAALVGQKGFTPGRA
KNTYGTGCFLLYHVGDKPVISTHGLLSTVAYDFDGKPQYALEGSIAVAGSSIKFLQNNLG
FIDSSAKISQLAETVEDNGGVTFVTAFSGLFAPYWYDDARGTLFGITAYTQKGHIARATL
EATCFQTKAILNAMEKDSGKKLAELAVDGGMCNSDLCMQTQADLISIPVERPRMLETTAL
GAAIAAGFAVGVWETFDELKNINTVGKTEFHPKITPEESKEKFSRWTKAVEMCKGWL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaccataattcagtttctagccatgaatccttcgtgtggcacgaacatgatcct
cttgaaatcatcgactcgatagaagtttgcattgaatgtgccgtaaaccaattcgagcaa
caaggtcattcagcgagacagatcaaagccgttggacttacaaatcagagagagacgaca
gttgtctgggaccacgaaacaggagaacctctagcaaatgctattgtctggacagatacc
agaaaccaggcattaatcagaaagttaaaagctcggcttggatctaatcaactgcagggt
ctctgcggtcttcctctgtcgacttatccctctgttggtaagcttttgtggttgattgaa
aacaatagtaaagtcgcagacgcatatgctcgaggtcagctggcgtttggcaccattgat
tcctgggtcatttacagactcaatggtggaccaaagaagaatgtgttcgttacagatccc
acgaatgcatctcgttcaatgttcatgaatttgcatactctaaagtatgatgagcagctt
ttagatttcttcagatttgatatggataaacttcatcttcccaagattgtccgctcgtcg
gatcgcgaatccttcggtgctcttacaacaggaatcttgaagggggttcctatcacgggt
gtgttaggtgatcaaagtgcggcgcttgtcggacaaaaaggcttcacgccaggtagagcg
aaaaatacctatgggacaggttgcttccttctctatcatgttggtgataagcctgtgatt
tccacacacggacttttgagtacagttgcgtatgactttgatggtaaaccacaatatgct
ttggaaggaagtatcgcggttgccggctccagtatcaaatttcttcagaataatcttggc
ttcattgactcttcggccaaaatcagtcagttagctgagactgtagaagataatggcggt
gtcacttttgtgacggcattcagtgggctattcgcaccatactggtacgacgacgctcgc
ggcacccttttcggtattacagcatatacacaaaaaggtcatatcgctcgcgctactttg
gaggcaacttgcttccaaacgaaagcaatattgaacgcaatggaaaaggacagtgggaag
aagctcgctgaactcgctgtcgatggaggcatgtgcaattctgatctctgcatgcaaact
caagccgatcttatatcgatcccggtcgaacgtccaagaatgctcgagacaacagcattg
ggtgccgccatcgctgcaggttttgccgtgggagtctgggaaacttttgacgaattaaag
aacatcaataccgtaggcaaaactgaatttcatcctaaaattactccagaagaaagtaag
gagaaattttcgcgatggacgaaagcagtcgaaatgtgtaagggttggctttag

DBGET integrated database retrieval system