KEGG   Botrytis cinerea: BC1G_12648Help
Entry
BC1G_12648        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11681  
helicase SWR1 [EC:3.6.4.12]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BC1G_12648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1607 aa AA seqDB search
MTTASEAPESEKIFDIPPIEDVLQTPKANGHAIENGDGEAPPSKRRRLSSETKTILKRKP
ESPPWKKVLAEGPTSFTVDGKRKSGRVNQIPLELQPPSEKRTTRGAAQKAVTSRSKQGNA
NGIHSSSNRDASTPGTSQTSKKSTSQNALKSPVKLSTSPKRSHRKSIPSELSSTQIRSSN
KKSTITRESQSTPSNSRLRRSGRASEVIQNDFTNSSPAIEAESMAEQTPKSTPTKIRLRV
KPASVPVVHPRSLPVPPKFGSFDEFWEQGQNIPVEAGGLYSAEDAVIFTEEDARKEAHTI
IQLEDAVERGVLGTSLNRPEKQEPMPPQYAHQDHLVRAALHFRMLMIREQKEHLRLAKQL
AEACRDEWTRRQPKSHEQLEAEERRASELRYKSVLKSLLGTWENVKAEVNRRRLVEWEAQ
EQARVRKALNEAVDISTQKLQARRAQQDSEEDTEDDDDEDEDANDDSDNVDNVDSDPSDD
EDNMSSSESEADEENIKHEDEQLTVDELREKYAALPDIVPASDDKEMPGNGSEDEDMESD
PSIDMDDDTDSSDEEEDSDEEEDNDVDEGSRADLLGFLLPSDIKDLETRQAELGPVAEVV
EDMEEDSTPVVADDAMDLDTEDSEVPPMSNGESIPPLMNGTSKKSPLIEELSTSEHHDSP
SKVNELLSATQPEEVPAMSPDRSSQPTPRTTETKPSEVDSASSVDLHQSSRRNTQSATPQ
PSNGLKTPVPFLLRGTLREYQHYGLDWLAGLYANNTNGILADEMGLGKTIQTIALLAHLA
CEHQVWGPHLVIVPTSVMLNWEMEFKKWCPGFKILTYYGNQEERKRKRAGWKDDDAWNVC
ITSYQLVIQDQQVFKRRQWHYMILDEAHNIKNFQSQRWQTMLNFNTRARLLLTGTPLQNN
LTELWSLLYFLMPSDGSEQGVGGFANLKEFQDWFKKPTEQILEHGREQMDDESKAIISKL
HKVLRPYLLRRLKADVEKQMPGKYEHVEFCRLSKRQRELYDSFLSRNDTRDTLASGNYLS
IINCLMQLRKVCNHPDLFLDRPIMTSFPMEKSAITDFEIKDLLVRRKMFRQEPMSRVSLD
FLNLVPAKHESLSGILASEINRLSARRALEVMREAQRARAQNAFTNLDPSTVKSNLVYLE
SASRWGRFEELQHCVYLNALRRQQKPIYGSSLIERLDLQLDQRPLQAKPKRRTKLIEWLE
DSSPIMRSMIPTFTSRSQALHTTIQKFACVTPPVVARDMNSVMFTPKGVSNFQSTIATRE
TDPFHEARMRLSIQFPDKRLLQYDCGKLQTLDKLLRKLQAGGHRALIFTQMTKVLDILEQ
FLNIHGHKYLRLDGATKIEQRQILTDRFNNDTRILAFILSSRSGGLGINLTGADTVIFYD
LDWNPAMDKQCQDRCHRIGQTRDVHIYRLVSEHTIEANILRKANQKRMLDDVVIQEGEFT
TDYFNKMNVRDVIGEEESDLMDGDAAANAAMDRVLGGPDNDKDVRRVFAQAEDREDVAAA
RVAEREIDQTDAADFDENAVTTSATPGGTGTPAEGGPTPGADGTPTAEDLMEIDEDELNA
WGQPVQGMDEYMLKFMSAQLANAPIELPKDKKKGKKGKDHRDRHRRR
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgcgtcagaagctcccgagagtgaaaaaatctttgatatacctccaattgaa
gatgtgctacaaacccctaaagcgaatggacatgcgattgaaaatggagatggagaagca
cccccgagcaagaggcgacgactcagcagcgagacaaagactatactgaagcgcaaaccc
gaatcgcctccctggaagaaagtcttagcagaaggtccaacctcttttactgtcgatggg
aaacgtaaatcaggccgtgtgaatcagataccattggagctacaacctccatccgagaag
aggacaacgcggggcgcggcgcaaaaggctgtcacctcgagaagtaaacaaggaaatgcg
aatggcattcactcatcttcaaatcgagatgcatccacacccggaacctcccaaacttct
aagaagtctaccagccaaaatgcattgaaatccccagtcaaattatcaacatcgccaaag
cgctcgcatcgaaaatccataccttcggagctgagttcaacacaaatacgctctagcaac
aaaaaatctacgattactagagaatcacagtcaacgccttcaaattcgaggttgcgccga
tcgggtcgagcttctgaggttattcagaatgactttacgaattcatcgccagcaatagaa
gcagagagtatggcagaacagaccccaaaatctacaccaacaaaaattagacttcgagtc
aagccagcatccgtccctgtggtacatccaaggtcgcttccggtgccgccaaaatttggg
tctttcgatgagttctgggagcaggggcaaaatatcccagtggaagcaggtgggttgtac
agcgccgaagatgcggtaattttcaccgaggaagatgccagaaaagaggcccatacaatc
atacagcttgaagatgcggtggaacgtggtgttttggggacttcattaaatcgtcctgag
aaacaagagcccatgccgccacagtatgcccaccaagatcatcttgtaagagctgccctc
catttcaggatgctcatgatcagggaacaaaaagaacatctaaggctcgcgaaacaactc
gccgaggcatgcagagatgaatggacccggcgacagccaaagtctcatgaacaactggag
gcggaggaaagaagggcgtctgaattgcgttataaaagcgtgcttaagagtctcttgggt
acctgggaaaatgttaaagcagaggtcaatcggcggcgcctagtcgaatgggaggcacag
gaacaggctcgggtacgaaaagccctcaacgaagctgtggatatttctacacaaaagctt
caggctcgcagagcgcaacaggattcggaagaagacactgaagatgacgatgatgaagat
gaggatgcaaatgatgattctgataatgtcgataatgtcgattctgaccctagtgacgat
gaagataatatgtcctcttcggaatcggaggctgacgaagagaatatcaaacacgaggat
gagcaacttactgttgatgaactgcgcgaaaaatacgccgccctaccagatattgtgcca
gccagcgatgacaaagaaatgcctggaaacggcagcgaagatgaagacatggaaagcgat
ccttctatagacatggatgatgacacagattctagcgacgaagaggaggacagcgatgag
gaagaggacaatgacgtggatgaagggagccgtgctgatcttcttggatttcttttacct
tccgatatcaaagatcttgaaacgaggcaagctgagttggggccagttgcagaagtggtg
gaagatatggaagaagactcaactccagtcgtagcagacgacgcaatggacttagatacc
gaggatagtgaagttccccccatgtccaatggagaatctataccgcctttaatgaatgga
acatccaaaaagtcacctctaatcgaagaactgtccacaagtgagcaccatgattcacct
agcaaggtaaatgaattgttatctgcaactcaaccagaagaggtcccagcgatgagtccc
gatcgaagcagccagcctactccaagaacaaccgaaactaagccctcagaggtggattcg
gcatcatctgtggatcttcatcaaagtagtcgccgcaacacacagagcgcaactccacaa
ccttcaaacggactgaaaactcccgttcccttcctcctacgtggcacccttagagaatat
caacactatggtttggattggcttgctggtctttatgcgaacaacacaaacggcattcta
gcagatgagatgggattggggaaaacaattcagaccatagccttattagctcatttggcc
tgcgaacaccaagtttggggcccgcatcttgtcatcgtacccactagtgttatgctcaac
tgggaaatggaattcaaaaagtggtgtccaggtttcaaaatcctaacttactacgggaat
caggaagagagaaaacgcaagcgtgctggctggaaggatgatgatgcttggaatgtatgc
attacatcataccaacttgtcattcaggatcagcaagtgttcaagcgacgacagtggcac
tacatgatccttgatgaagcccacaacatcaagaactttcaatctcaaaggtggcaaact
atgttgaatttcaatactcgagcgcggttattactaaccggtactcctttgcaaaataac
ttgacggaattatggtccttactctacttcttgatgccctcggatggaagcgagcaaggt
gttggtgggtttgcaaatttgaaagaattccaggactggtttaagaagccgacggaacaa
atcttggagcatggcagggagcaaatggatgatgaatcgaaggcaatcattagcaaactt
cacaaggttctcaggccttaccttctcaggagattgaaagcagatgtcgaaaaacaaatg
cccggaaagtacgagcacgttgagttttgccgtttgtccaaaagacaacgtgagctctat
gatagctttctgagtcgaaatgataccagagatacccttgcatcgggtaattatctttcc
atcatcaattgtttgatgcaactgcgaaaggtttgtaatcatccggatctctttctagat
cgacccattatgacttcttttcccatggaaaaatctgcgatcaccgacttcgagattaag
gatcttctagttcgtagaaaaatgttccgtcaggagcctatgtctagagttagcttggat
ttcttgaatctcgtgcctgcgaagcatgaatccttgtctggtatcttggcctctgaaatc
aacagactcagtgcccggcgtgctctagaagtaatgagggaggctcagcgtgcaagagcc
cagaatgcatttaccaacctcgacccttcaacagtcaaatccaatctggtgtatttagaa
agtgcttccaggtggggaagatttgaagagcttcaacattgcgtatatcttaatgcactt
cgacgacagcagaaacctatctatggtagttctctcattgaacgtctagatcttcaactt
gatcagcgcccactacaagcgaagccgaagcgacgaaccaagttgatagaatggctggag
gactcttcgccgattatgcgttcaatgattccgacatttacatcacgatctcaggcctta
cacacaaccatccaaaaatttgcttgtgtaactccgcctgtagtggcgcgagatatgaac
tcagtcatgttcacacccaagggtgtaagtaattttcaaagcaccatcgccactcgagaa
acagatccatttcatgaggcacgcatgagactatccattcaatttccggacaagcgtctt
ttgcaatatgactgcggtaaattgcagactctggacaagttattacgcaaactacaagct
ggcggacaccgagctctgatcttcactcaaatgacaaaggtacttgacattcttgagcaa
tttctgaatattcacggacacaaatacctacgacttgatggagctaccaagattgagcaa
cgacaaattctcacggatcgcttcaacaacgatactcgaattcttgcttttatattatcc
agtcgatcgggcggtctaggaattaatttgactggtgcggatactgttatcttctatgat
ttggattggaatccagccatggacaagcaatgtcaagatcgttgccatcgtatcggacaa
acaagagatgttcacatttaccgtctggtctcggaacatactatcgaggccaacatctta
cgcaaagcaaaccaaaagcgtatgctcgacgatgtcgttattcaagaaggagagtttacc
acggattacttcaacaagatgaacgtacgagatgttattggagaggaagaatctgatctt
atggatggtgatgcagcagccaatgcagccatggatcgagttttgggtggccctgacaat
gacaaagatgttcgacgtgttttcgctcaagccgaagatcgtgaagatgtcgctgcagct
cgagttgccgaacgagaaatcgatcagaccgatgcagccgatttcgatgaaaatgccgta
acaacgtctgctactcccggtggaacgggaactcctgcagaaggcggtccaactcctggc
gccgatggaacgcctaccgctgaagacctaatggagattgatgaagatgagcttaatgct
tgggggcagccagtgcaagggatggatgaatacatgctgaaattcatgtctgctcaacta
gcaaatgcacccattgagttgccaaaggacaagaagaagggcaagaagggcaaagaccat
cgagatcggcatagacgaagatga

DBGET integrated database retrieval system