KEGG   Botrytis cinerea: BC1G_12846Help
Entry
BC1G_12846        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1432 aa AA seqDB search
MTAVAVQHGAPRQQHNLHRSNPAPNLNTPSGQQPQPQNHTFATAPNSQQLPHSGPAMNGM
NGTLGTMNSRHTVSNDPIQPANGVEAGSAYAPANLDRSNSTSQNGSSTRPTTSAGATAES
SQDDSEPDRIRRRPAALLQRSKSDYGPRGDDTNVDMEEDIQDWGERHGFGTNYASEDFDF
FSPVANEDREGADYFCVKCECVIAVSKNGSAFRRAQHSRLRSSLGWALGVDFVGVGLETS
TDIVQQNWYMYFTDKRHETTGNPKSLGYELQDWRMKDRLKTVSAALAICLNIGVEPPDQL
KTTPGAKLEAWQDPSHPPVQKALETIGKSLQAQYETLAIRTRYKQYLDPSVEETKKFCIS
LRRNAKEERVLFHYNGHGVPKPTSSGEIWVFNKNYTQYIPVSLYDLQTWLQAPTFFVWDC
SDSGNILNNFHRFVDKHEQEELENSKKDPNYVVTNYKPYIHLAACGIKENLPTNPLLPAD
VFTACLTTPIEMALWFFVLQNPLPSQVSPERAKKLPGRLQERRTPLGELNWIFTAITDTI
AWTTLPRPLFRKFFRQDLMVAALFRNFLLAQRIMSAYGCHPQSYPQLPDTHQHSLWESWD
LAVEMALAQLPSLEMKESGQLPDYEFQNSSFFTEQLTAFEVYLTQGAVTHKAPDQLPVVL
QVLLSQQHRVRALILLGKFLDMGPWAVNLALSIGIFPYVLKLLQSAAAELKPVMVFIWTR
VLAVDLTCQQDLLKDSGYNYFSSILKPNEGLPVVDSLEHKAMCAFILAMLCNGYKQGQNV
CNQTDIMTYCLTHLQNADNPLLRQWACLCISQLWNDLPEAKWRGIRENAPAKLSGLVRDV
CCEVRAAMLYAMTTFLGIPDLTDEVARNEESISWTVIELANDGNAMVRKELLVYFSKFIH
RYESKFWVVAFEQLQEEREYRQSPPLDDGNDHKMGLHYARMDNRNKDGTIKATAQGLSHN
SIFAVVWKHVLIMAIDPHPEVQRNATIIVDALHLSLLRSPVGAAARKLFDDISRISAKPK
ASKSHTSETRPSTPTRQDTLSSTQSSQQGLLKRTASYLFTLPFGGSTGEVTPPDSTGRSG
LKSPGLNRNSLPARSRLPPDFNSPPEQNDIASTPGTYHAANEPTSGGFQPRNLSEPCTIP
LESTFLEWSIEYFREPQMKPNEAEEPGSTDYNERLWRRSRNEAILRDTQPQKEIAGNGKW
THATGFFNNSSQPTKMTLHQFEDHLAVSDDRDTICVWDWKKQDRLSRFSNGNPEGSRISD
LQFINEDDQAFLLTGSSDGVIRIYRNYDSDKKIEVASAWRALTHLVPSNVNSGMVFDWQQ
VTGKLLVAGDVKVIRVWAAAPELCVVDINARSGSCVTSLTSDQMTGNVFVAGFGDGAIRV
FDARNKPQEAMVKKWKDESDRVWIKSVHMQRGGQRELLSASRNGKVKLWDIE
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttgccgttcagcatggagctccccgccaacaacacaacctacaccgatca
aatcccgctccaaatttaaatacaccttcaggtcaacaaccacaacctcaaaaccatacg
tttgccactgcgccgaactcacaacagctgccacattcaggcccagcaatgaatggtatg
aatggcacgttaggaaccatgaattcgaggcatactgtgagcaatgatccaatccagcct
gctaacggcgtagaagctggatctgcatatgcgccggcgaacttggatcgcagtaatagt
acatcccagaatggatcaagcacacggccaacaacttcggctggagctaccgcagaatcg
tcacaagacgattcggagccggatagaatacggcgcagaccagctgcattacttcaaaga
tccaagagtgactatggaccgaggggcgatgatacaaatgtagatatggaagaagatata
caagattggggagaaaggcacgggtttggaactaattatgcatctgaagacttcgatttt
ttctcgcccgtagcaaatgaagatcgggaaggcgcagactatttctgtgtgaaatgtgaa
tgtgtgattgcagtctccaaaaacggctcagcattccgtcgagcgcaacatagccgcctc
cgatcttcactgggctgggcgcttggagtcgactttgtgggcgtaggcttagaaacaagt
actgatatcgtacaacagaactggtatatgtactttacggataaacgacacgaaacgacg
ggcaaccctaaatcactgggatatgaacttcaggattggcggatgaaggatcgtctaaaa
accgtgtccgcagcactggcaatatgcctaaatattggagtcgaaccgcctgatcaactg
aagactacacctggtgcaaagttggaggcttggcaggatccttcacaccctcctgtacaa
aaggctctcgagacaattggaaaatccttacaagcccaatacgagacattggccattcga
acaagatacaagcaatatttggatccatccgttgaagagacgaagaagttctgcatatca
cttcgtcggaatgctaaagaagaacgagttctctttcattacaatggccatggtgtccca
aagcctacttcatctggtgaaatttgggtatttaacaagaactatacgcagtacattccg
gtatcattgtatgatctacaaacatggcttcaagcacccactttcttcgtttgggactgt
tcagattccggtaacatcctgaataactttcatcgctttgttgacaagcatgaacaagaa
gagcttgaaaattcgaaaaaggatccaaattatgtagttacaaactataagccttacatt
cacctggcagcatgtggaataaaggaaaacctacctacaaatcctctacttcctgctgat
gtcttcacagcatgcctaacaacccctattgaaatggccttgtggtttttcgttctacaa
aatcctctcccatcacaagtatcaccagagcgagccaaaaagcttcccggtagactacaa
gaaaggcggactcctctaggagagctaaactggatctttacagccattacagataccata
gcttggactaccctccctaggcccttgttcaggaagttcttcagacaagatttgatggtc
gcagctctattcagaaactttctgttagcgcagagaatcatgtcagcttatggatgccac
ccacaatcatacccgcagcttccagacactcatcaacattctctttgggaaagttgggat
ttagccgtagaaatggctttggctcaattgccatcgttagagatgaaggagtctggacaa
cttccagattatgaattccagaactccagtttcttcacggaacaactaacagcgtttgag
gtttatctgacgcagggcgctgtaactcacaaagctcccgaccagcttccagttgttctt
caagttctccttagtcaacagcatcgagtacgagctttgatactgttagggaagttcctt
gacatgggcccttgggctgtaaaccttgctttgagcataggcatctttccatacgttttg
aaattgttacaatcagccgcagcagaattgaagcccgtgatggtgtttatctggactcgt
gtactggctgttgatctcacatgtcagcaagatttgttgaaagatagtggctacaactac
ttctcaagtatattaaagcccaatgaaggtcttccagtagtggatagccttgaacacaaa
gctatgtgtgcgtttattctagctatgctctgcaatggatacaagcaaggtcaaaatgtc
tgcaaccaaacagatatcatgacttactgtttgacgcacttgcagaatgcagacaaccca
ctcttgcgacaatgggcgtgtctatgtatcagtcagctttggaatgatctccctgaagcg
aaatggcgaggtatcagagagaatgcgcctgcaaaattatccggtctggttcgcgatgta
tgctgcgaagtcagagctgccatgttatacgccatgacaacttttctgggaatccccgac
ctgacagacgaagttgctcgaaatgaggagtcaatatcgtggaccgttatagaactagct
aatgatggaaatgctatggtccgcaaagaactgctagtgtatttctctaagtttatacat
cgatatgagagtaaattctgggtagtggcattcgaacagctgcaggaggaacgagagtat
agacaatcaccccctctcgacgatggaaatgatcacaaaatgggattgcactatgctcgt
atggacaacagaaataaggatggtaccatcaaagccacagctcagggcttgtctcacaat
tccatttttgccgtggtttggaaacacgttctaataatggcaatcgatccacatcctgaa
gtccagcgcaatgcaaccattatcgtggatgccctccatttatcactccttcgctcgcca
gttggggccgccgcccgtaaattatttgatgacataagtcgcatctcagcaaaaccaaag
gcatcgaaatcacatacatcggaaacaagacccagtacacctactcgacaggataccttg
tcaagcacacagtcgagccagcaaggcttacttaaaagaacagctagttacttgtttacc
ctacctttcggtggttctactggtgaagtgaccccacctgactcaaccggaagatctggt
ttgaagtcgcctggcctaaatcgaaattctttgccagcgcgatcacgtcttccgccagac
tttaactccccaccggagcaaaatgacatcgcatcgaccccaggcacataccatgcagca
aatgagccaacatcgggcggctttcaacctcgaaacctatcagaaccatgtaccatacca
ttggaaagcactttcctggaatggtcgattgaatatttccgcgaaccccaaatgaagcca
aacgaagctgaggagcccggcagtactgattacaacgaaagactttggcgaagatcaagg
aatgaagcaattctccgcgacactcaaccccagaaagaaatcgctggtaatggcaaatgg
acacatgctactggatttttcaataactctagccaaccaacaaaaatgactctccatcaa
tttgaagatcatcttgctgtgtctgatgatcgcgatacgatttgtgtttgggattggaag
aagcaagaccgtttaagccgattttcaaatggtaatccggaaggttccagaattagcgat
ctccaatttatcaatgaggacgaccaagccttcttgttgacggggtcttcggatggtgtc
attcgtatctataggaattatgattctgacaaaaagattgaggtcgcttcggcatggaga
gctttgacacatctcgtcccaagtaacgtcaattctggaatggtatttgactggcaacaa
gttactggaaagcttctggtagccggtgatgtaaaggtgatcagagtgtgggctgcggcg
ccagagctttgtgtcgtggatattaatgctcggtctggttcttgtgtcacgtccttgact
tctgatcaaatgacaggtaatgttttcgtggcaggttttggtgatggagccataagagta
tttgatgctagaaacaagccacaagaagctatggttaagaaatggaaagacgaatctgac
agggtatggatcaagagtgtgcatatgcaacgaggtggtcaaagagagcttctgtccgcc
agtcgtaacgggaaagttaaactttgggatatagaatga

DBGET integrated database retrieval system