KEGG   Botrytis cinerea: BC1G_12932Help
Entry
BC1G_12932        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     BC1G_12932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 585 aa AA seqDB search
MRKSLFALAGAAATASAESLTDICTTAVAKAALPANGTLLGSSVIPSSVTANVVYNTSVS
GQTFFPDATVDFCNVTFAYTHNGRGDNVVLTLWLPSPENFQNRWLSSGGMAYSINSGTTN
LVGGVMYGAASGLTDGGFDTVFDSVFLLDNGTINWEPTYMFGYQAIGELTTLGKEFTKQF
YDMGDDKLYAYYQGCSDGGREGWSQAQRWGDIYDGIIAGAPAFRYGQQQVNHLFSNVVEQ
TLDYYPSSCELELIVNETISNCDALDGKVDGVVARTDLCKLQYNINQTIGLPYSCAASSG
GGIGLGYGKHKRQMMGGGATNPAANGTVSAEAVAVAQTILDGLHDSQGRRAYLSYQPSAD
FDDAATTYNSDTDSYEISIAGAGGEWVARFLELQDLDNLSTLDNVTYDTLVQWMVQGWTR
YEDSLQTNNPDLTDIYNYGGKILHFHGESDPSVPAASSVHYYESVRSIMYPGLSFNESTE
ALKEWYRLYMIPGAAHCAINSEQENGPFPQTNLQVLIEWVENGTVPVTLNATHLAGDYKG
DNAQICAWPLRPLWINNGTTQDCVFDQASYDTWNYTFDAYKRPLY
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagtccctcttcgcactagcaggcgctgctgcgaccgcttctgcagaatctctg
accgacatctgcacgacagccgtcgctaaagcggctctacccgcgaacggcacgttgtta
gggagttccgtcatcccatcgtcggttacagcaaacgtcgtctacaacacttctgtcagc
gggcaaactttcttccctgatgctactgtcgatttctgcaacgtaactttcgcttatacc
cacaatggtcgtggggacaatgtggtactaacactctggttgccatccccagagaacttc
cagaacagatggctctcatctggtggaatggcttacagcatcaattcgggtactactaac
cttgtcggaggtgttatgtatggtgccgcgtctggtctcactgacggtggatttgatact
gtgttcgactccgtatttcttctcgataatggtacaatcaactgggagcccacttacatg
tttggttatcaagctattggcgagttaactacgcttgggaaagaattcactaagcagttt
tacgatatgggtgatgataagctctacgcttattatcaaggttgttccgatggtggtcgt
gaagggtggagtcaagctcaacgctggggtgatatatatgacggcattattgccggtgca
ccagctttccgatatggtcaacagcaagtcaaccatctcttctcgaatgttgtcgagcaa
acacttgattattacccatcatcatgcgagctcgaactaatcgtcaacgaaaccatctct
aactgcgacgcccttgatggcaaggttgacggtgtggtggcccgaacagacctttgcaag
cttcaatacaatatcaaccaaactatcggcttgccttacagttgtgccgctagctccggt
ggtggcattggccttggctacggtaagcacaagagacagatgatgggaggaggagctacc
aatccagctgcaaatggaactgtatcagccgaggcagtagcagttgctcaaaccattctc
gatgggttacatgattctcaaggtcgacgtgcctatctctcatatcaaccatctgccgat
ttcgatgatgcagcaaccacttacaattccgataccgattcatacgaaatcagcattgct
ggagctggtggtgaatgggtcgctagattccttgagctacaggatcttgataacctttct
actttggataatgtcacctatgataccttggtgcaatggatggttcaaggatggaccaga
tacgaggattcgctccagaccaacaacccggatctcactgatatctacaactacggaggt
aaaattcttcatttccacggtgaatccgatcctagtgtgcctgccgcttcttcagttcac
tactatgagtctgtccgcagcatcatgtatcctggtctatctttcaacgagagcactgaa
gctttgaaagaatggtaccgcttgtacatgattccgggtgccgctcactgcgccatcaac
agcgaacaggagaatggtcctttccctcaaaccaacttgcaggttttgattgagtgggtg
gaaaatggcacggttcctgtaaccctcaatgctacccacttggctggtgattacaaaggt
gacaacgctcaaatctgtgcttggcctcttcgtcctctctggataaacaatggtactacc
caggattgcgtctttgaccaagcttcttacgatacttggaactacactttcgacgcttac
aagcgaccattgtattaa

DBGET integrated database retrieval system